This is Bugs in view mode; [Up]
From: sanguish@digifix.com Newsgroups: comp.sys.next.advocacy,comp.sys.next.announce,comp.sys.next.hardware,comp.sys.next.software,comp.sys.next.misc,comp.sys.next.sysadmin,comp.sys.next.bugs,comp.sys.next.programmer Subject: NEXTSTEP/OpenStep Resources on the Net Supersedes: <3142915339621@digifix.com> Date: 10 Jan 1999 04:45:03 GMT Organization: Digital Fix Development Message-ID: <6325915944426@digifix.com> Topics include: Major OpenStep/NEXTSTEP World Wide Web Sites OpenStep/NEXTSTEP/Rhapsody Related Usenet Newsgroups Major OpenStep/NEXTSTEP FTP sites NeXTanswers Major OpenStep/NEXTSTEP World Wide Web Sites ============================================ The following sites are a sample of the OpenStep related WWW sites available. A comprehensive list is available on Stepwise. Stepwise OpenStep/Rhapsody Information Server http://www.stepwise.com Stepwise has been serving the OpenStep/NEXTSTEP community since March 1994. Some of the many resources on the site include: original YellowBox and Rhapsody articles, mailing list information, extensive listing of FTP and WWW sites related to Rhapsody, OpenStep and NEXTSTEP, OpenStep related Frequently Asked Questions. NeXT Software Archives @ Peak.org http://www.peak.org/next http://www.peak.org/openstep http://www.peak.org/rhapsody PEAK is the premier NeXTStep/OpenStep FTP site in North America. Apple Enterprise Software Group (formerly NeXT Computer, Inc.) http://enterprise.apple.com http://enterprise.apple.com/NeXTanswers Here is where you'll find the NeXTanswers archive, with information on OpenStep installation, drivers and software patches. Apple Computer's Rhapsody Developer Release Site http://gemma.apple.com/rhapsody/rhapdev/rhapsody.html These pages are focused on tools and resources you need to develop great Rhapsody software products.. Rhapsody Developer Documentation http://gemma.apple.com/techinfo/techdocs/rhapsody/rhapsody.html WebObjects Documentation http://gemma.apple.com/techinfo/techdocs/enterprise/enterprise.html OpenStep/NEXTSTEP/Rhapsody Related Usenet Newsgroups ==================================================== COMP.SYS.NEXT.ADVOCACY This is the "why NEXTSTEP is better (or worse) than anything else in the known universe" forum. It was created specifically to divert lengthy flame wars from .misc. COMP.SYS.NEXT.ANNOUNCE Announcements of general interest to the NeXT community (new products, FTP submissions, user group meetings, commercial announcements etc.) This is a moderated newsgroup, meaning that you can't post to it directly. Submissions should be e-mailed to next-announce@digifix.com where the moderator (Scott Anguish) will screen them for suitability. Messages posted to announce should NOT be posted or crossposted to any other comp.sys.next groups. COMP.SYS.NEXT.BUGS A place to report verifiable bugs in NeXT-supplied software. Material e-mailed to Bug_NeXT@NeXT.COM is not published, so this is a place for the net community find out about problems when they're discovered. This newsgroup has a very poor signal/noise ratio--all too often bozos post stuff here that really belongs someplace else. It rarely makes sense to crosspost between this and other c.s.n.* newsgroups, but individual reports may be germane to certain non-NeXT-specific groups as well. COMP.SYS.NEXT.HARDWARE Discussions about NeXT-label hardware and compatible peripherals, and non-NeXT-produced hardware (e.g. Intel) that is compatible with NEXTSTEP. In most cases, questions about Intel hardware are better asked in comp.sys.ibm.pc.hardware. Questions about SCSI devices belong in comp.periphs.scsi. This isn't the place to buy or sell used NeXTs--that's what .marketplace is for. COMP.SYS.NEXT.MARKETPLACE NeXT stuff for sale/wanted. Material posted here must not be crossposted to any other c.s.n.* newsgroup, but may be crossposted to misc.forsale.computers.workstation or appropriate regional newsgroups. COMP.SYS.NEXT.MISC For stuff that doesn't fit anywhere else. Anything you post here by definition doesn't belong anywhere else in c.s.n.*--i.e. no crossposting!!! COMP.SYS.NEXT.PROGRAMMER Questions and discussions of interest to NEXTSTEP programmers. This is primarily a forum for advanced technical material. Generic UNIX questions belong elsewhere (comp.unix.questions), although specific questions about NeXT's implementation or porting issues are appropriate here. Note that there are several other more "horizontal" newsgroups (comp.lang.objective-c, comp.lang.postscript, comp.os.mach, comp.protocols.tcp-ip, etc.) that may also be of interest. COMP.SYS.NEXT.SOFTWARE This is a place to talk about [third party] software products that run on NEXTSTEP systems. COMP.SYS.NEXT.SYSADMIN Stuff relating to NeXT system administration issues; in rare cases this will spill over into .programmer or .software. ** RELATED NEWSGROUPS ** COMP.SOFT-SYS.NEXTSTEP Like comp.sys.next.software and comp.sys.next.misc combined. Exists because NeXT is a software-only company now, and comp.soft-sys is for discussion of software systems with scope similar to NEXTSTEP. COMP.LANG.OBJECTIVE-C Technical talk about the Objective-C language. Implemetations discussed include NeXT, Gnu, Stepstone, etc. COMP.OBJECT Technical talk about OOP in general. Lots of C++ discussion, but NeXT and Objective-C get quite a bit of attention. At times gets almost philosophical about objects, but then again OOP allows one to be a programmer/philosopher. (The original comp.sys.next no longer exists--do not attempt to post to it.) Exception to the crossposting restrictions: announcements of usenet RFDs or CFVs, when made by the news.announce.newgroups moderator, may be simultaneously crossposted to all c.s.n.* newsgroups. Getting the Newsgroups without getting News =========================================== Thanks to Michael Ross at antigone.com, the main NEXTSTEP groups are now available as a mailing list digest as well. next-nextstep next-advocacy next-announce next-bugs next-hardware next-marketplace next-misc next-programmer next-software next-sysadmin object lang-objective-c (For a full description, send mail to listserv@antigone.com). The subscription syntax is essentially the same as Majordomo's. To subscribe, send a message to *-request@lists.best.com saying: subscribe where * is the name of the list e.g. next-programmer-request@lists.best.com Major OpenStep/NEXTSTEP FTP sites ================================= ftp://ftp.next.peak.org The main site for North American submissions formerly ftp.cs.orst.edu ftp://ftp.peanuts.org: (Peanuts) Located in Germany. Comprehensive archive site. Very well maintained. ftp://ftp.nluug.nl/pub/comp/next NeGeN/NiNe (NEXTSTEP Gebruikers Nederland/NeXTSTEP in the Netherlands) ftp://cube.sm.dsi.unimi.it (Italian NEXTSTEP User Group) ftp://ftp.nmr.embl-heidelberg.de/pub/next eduStep ftp://ftp.next.com: See below ftp.next.com and NextAnswers@next.com ===================================== [from the document ftp://ftp.next.com/pub/NeXTanswers/1000_Help] Welcome to the NeXTanswers information retrieval system! This system allows you to request online technical documents, drivers, and other software, which are then sent to you automatically. You can request documents by fax or Internet electronic mail, read them on the world-wide web, transfer them by anonymous ftp, or download them from the BBS. NeXTanswers is an automated retrieval system. Requests sent to it are answered electronically, and are not read or handled by a human being. NeXTanswers does not answer your questions or forward your requests. USING NEXTANSWERS BY E-MAIL To use NeXTanswers by Internet e-mail, send requests to nextanswers@next.com. Files are sent as NeXTmail attachments by default; you can request they be sent as ASCII text files instead. To request a file, include that file's ID number in the Subject line or the body of the message. You can request several files in a single message. You can also include commands in the Subject line or the body of the message. These commands affect the way that files you request are sent: ASCII causes the requested files to be sent as ASCII text SPLIT splits large files into 95KB chunks, using the MIME Message/Partial specification REPLY-TO address sets the e-mail address NeXTanswers uses These commands return information about the NeXTanswers system: HELP returns this help file INDEX returns the list of all available files INDEX BY DATE returns the list of files, sorted newest to oldest SEARCH keywords lists all files that contain all the keywords you list (ignoring capitalization) For example, a message with the following Subject line requests three files: Subject: 2101 2234 1109 A message with this body requests the same three files be sent as ASCII text files: 2101 2234 1109 ascii This message requests two lists of files, one for each search: Subject: SEARCH Dell SCSI SEARCH NetInfo domain NeXTanswers will reply to the address in your From: line. To use a different address either set your Reply-To: line, or use the NeXTanswers command REPLY-TO If you have any problem with the system or suggestions for improvement, please send mail to nextanswers-request@next.com. USING NEXTANSWERS BY FAX To use NeXTanswers by fax, call (415) 780-3990 from a touch-tone phone and follow the instructions. You'll be asked for your fax number, a number to identify your fax (like your phone extension or office number), and the ID numbers of the files you want. You can also request a list of available files. When you finish entering the file numbers, end the call and the files will be faxed to you. If you have problems using this fax system, please call Technical Support at 1-800-848-6398. You cannot use the fax system outside the U.S & Canada. USING NEXTANSWERS VIA THE WORLD-WIDE WEB To use NeXTanswers via the Internet World-Wide Web connect to NeXT's web server at URL http://www.next.com. USING NEXTANSWERS BY ANONYMOUS FTP To use NeXTanswers by Internet anonymous FTP, connect to FTP.NEXT.COM and read the help file pub/NeXTanswers/README. If you have problems using this, please send mail to nextanswers-request@next.com. USING NEXTANSWERS BY MODEM To use NeXTanswers via modem call the NeXTanswers BBS at (415) 780-2965. Log in as the user "guest", and enter the Files section. From there you can download NeXTanswers documents. FOR MORE HELP... If you need technical support for NEXTSTEP beyond the information available from NeXTanswers, call the Support Hotline at 1-800-955-NeXT (outside the U.S. call +1-415-424-8500) to speak to a NEXTSTEP Technical Support Technician. If your site has a NeXT support contract, your site's support contact must make this call to the hotline. Otherwise, hotline support is on a pay-per-call basis. Thanks for using NeXTanswers! _________________________________________________________________ Written by: Eric P. Scott ( eps@toaster.SFSU.EDU ) and Scott Anguish ( sanguish@digifix.com ) Additions from: Greg Anderson ( Greg_Anderson@afs.com ) Michael Pizolato ( alf@epix.net ) Dan Grillo ( dan_grillo@next.com )
From: mamax@mail.com <mamax@mail.com> Newsgroups: comp.sys.next.bugs Subject: test Date: 16 Jan 99 08:28:15 +-0300 Organization: Online Resource Center Message-ID: <8d50.771f.e6@trhwr> NNTP-Posting-Date: 16 Jan 1999 05:28:18 GMT content-length: 21 http://lba.da.ru/
From: sanguish@digifix.com Newsgroups: comp.sys.next.advocacy,comp.sys.next.announce,comp.sys.next.hardware,comp.sys.next.software,comp.sys.next.misc,comp.sys.next.sysadmin,comp.sys.next.bugs,comp.sys.next.programmer Subject: NEXTSTEP/OpenStep Resources on the Net Supersedes: <6325915944426@digifix.com> Date: 17 Jan 1999 04:45:19 GMT Organization: Digital Fix Development Message-ID: <306916549240@digifix.com> Topics include: Major OpenStep/NEXTSTEP World Wide Web Sites OpenStep/NEXTSTEP/Rhapsody Related Usenet Newsgroups Major OpenStep/NEXTSTEP FTP sites NeXTanswers Major OpenStep/NEXTSTEP World Wide Web Sites ============================================ The following sites are a sample of the OpenStep related WWW sites available. A comprehensive list is available on Stepwise. Stepwise OpenStep/Rhapsody Information Server http://www.stepwise.com Stepwise has been serving the OpenStep/NEXTSTEP community since March 1994. Some of the many resources on the site include: original YellowBox and Rhapsody articles, mailing list information, extensive listing of FTP and WWW sites related to Rhapsody, OpenStep and NEXTSTEP, OpenStep related Frequently Asked Questions. NeXT Software Archives @ Peak.org http://www.peak.org/next http://www.peak.org/openstep http://www.peak.org/rhapsody PEAK is the premier NeXTStep/OpenStep FTP site in North America. Apple Enterprise Software Group (formerly NeXT Computer, Inc.) http://enterprise.apple.com http://enterprise.apple.com/NeXTanswers Here is where you'll find the NeXTanswers archive, with information on OpenStep installation, drivers and software patches. Apple Computer's Rhapsody Developer Release Site http://gemma.apple.com/rhapsody/rhapdev/rhapsody.html These pages are focused on tools and resources you need to develop great Rhapsody software products.. Rhapsody Developer Documentation http://gemma.apple.com/techinfo/techdocs/rhapsody/rhapsody.html WebObjects Documentation http://gemma.apple.com/techinfo/techdocs/enterprise/enterprise.html OpenStep/NEXTSTEP/Rhapsody Related Usenet Newsgroups ==================================================== COMP.SYS.NEXT.ADVOCACY This is the "why NEXTSTEP is better (or worse) than anything else in the known universe" forum. It was created specifically to divert lengthy flame wars from .misc. COMP.SYS.NEXT.ANNOUNCE Announcements of general interest to the NeXT community (new products, FTP submissions, user group meetings, commercial announcements etc.) This is a moderated newsgroup, meaning that you can't post to it directly. Submissions should be e-mailed to next-announce@digifix.com where the moderator (Scott Anguish) will screen them for suitability. Messages posted to announce should NOT be posted or crossposted to any other comp.sys.next groups. COMP.SYS.NEXT.BUGS A place to report verifiable bugs in NeXT-supplied software. Material e-mailed to Bug_NeXT@NeXT.COM is not published, so this is a place for the net community find out about problems when they're discovered. This newsgroup has a very poor signal/noise ratio--all too often bozos post stuff here that really belongs someplace else. It rarely makes sense to crosspost between this and other c.s.n.* newsgroups, but individual reports may be germane to certain non-NeXT-specific groups as well. COMP.SYS.NEXT.HARDWARE Discussions about NeXT-label hardware and compatible peripherals, and non-NeXT-produced hardware (e.g. Intel) that is compatible with NEXTSTEP. In most cases, questions about Intel hardware are better asked in comp.sys.ibm.pc.hardware. Questions about SCSI devices belong in comp.periphs.scsi. This isn't the place to buy or sell used NeXTs--that's what .marketplace is for. COMP.SYS.NEXT.MARKETPLACE NeXT stuff for sale/wanted. Material posted here must not be crossposted to any other c.s.n.* newsgroup, but may be crossposted to misc.forsale.computers.workstation or appropriate regional newsgroups. COMP.SYS.NEXT.MISC For stuff that doesn't fit anywhere else. Anything you post here by definition doesn't belong anywhere else in c.s.n.*--i.e. no crossposting!!! COMP.SYS.NEXT.PROGRAMMER Questions and discussions of interest to NEXTSTEP programmers. This is primarily a forum for advanced technical material. Generic UNIX questions belong elsewhere (comp.unix.questions), although specific questions about NeXT's implementation or porting issues are appropriate here. Note that there are several other more "horizontal" newsgroups (comp.lang.objective-c, comp.lang.postscript, comp.os.mach, comp.protocols.tcp-ip, etc.) that may also be of interest. COMP.SYS.NEXT.SOFTWARE This is a place to talk about [third party] software products that run on NEXTSTEP systems. COMP.SYS.NEXT.SYSADMIN Stuff relating to NeXT system administration issues; in rare cases this will spill over into .programmer or .software. ** RELATED NEWSGROUPS ** COMP.SOFT-SYS.NEXTSTEP Like comp.sys.next.software and comp.sys.next.misc combined. Exists because NeXT is a software-only company now, and comp.soft-sys is for discussion of software systems with scope similar to NEXTSTEP. COMP.LANG.OBJECTIVE-C Technical talk about the Objective-C language. Implemetations discussed include NeXT, Gnu, Stepstone, etc. COMP.OBJECT Technical talk about OOP in general. Lots of C++ discussion, but NeXT and Objective-C get quite a bit of attention. At times gets almost philosophical about objects, but then again OOP allows one to be a programmer/philosopher. (The original comp.sys.next no longer exists--do not attempt to post to it.) Exception to the crossposting restrictions: announcements of usenet RFDs or CFVs, when made by the news.announce.newgroups moderator, may be simultaneously crossposted to all c.s.n.* newsgroups. Getting the Newsgroups without getting News =========================================== Thanks to Michael Ross at antigone.com, the main NEXTSTEP groups are now available as a mailing list digest as well. next-nextstep next-advocacy next-announce next-bugs next-hardware next-marketplace next-misc next-programmer next-software next-sysadmin object lang-objective-c (For a full description, send mail to listserv@antigone.com). The subscription syntax is essentially the same as Majordomo's. To subscribe, send a message to *-request@lists.best.com saying: subscribe where * is the name of the list e.g. next-programmer-request@lists.best.com Major OpenStep/NEXTSTEP FTP sites ================================= ftp://ftp.next.peak.org The main site for North American submissions formerly ftp.cs.orst.edu ftp://ftp.peanuts.org: (Peanuts) Located in Germany. Comprehensive archive site. Very well maintained. ftp://ftp.nluug.nl/pub/comp/next NeGeN/NiNe (NEXTSTEP Gebruikers Nederland/NeXTSTEP in the Netherlands) ftp://cube.sm.dsi.unimi.it (Italian NEXTSTEP User Group) ftp://ftp.nmr.embl-heidelberg.de/pub/next eduStep ftp://ftp.next.com: See below ftp.next.com and NextAnswers@next.com ===================================== [from the document ftp://ftp.next.com/pub/NeXTanswers/1000_Help] Welcome to the NeXTanswers information retrieval system! This system allows you to request online technical documents, drivers, and other software, which are then sent to you automatically. You can request documents by fax or Internet electronic mail, read them on the world-wide web, transfer them by anonymous ftp, or download them from the BBS. NeXTanswers is an automated retrieval system. Requests sent to it are answered electronically, and are not read or handled by a human being. NeXTanswers does not answer your questions or forward your requests. USING NEXTANSWERS BY E-MAIL To use NeXTanswers by Internet e-mail, send requests to nextanswers@next.com. Files are sent as NeXTmail attachments by default; you can request they be sent as ASCII text files instead. To request a file, include that file's ID number in the Subject line or the body of the message. You can request several files in a single message. You can also include commands in the Subject line or the body of the message. These commands affect the way that files you request are sent: ASCII causes the requested files to be sent as ASCII text SPLIT splits large files into 95KB chunks, using the MIME Message/Partial specification REPLY-TO address sets the e-mail address NeXTanswers uses These commands return information about the NeXTanswers system: HELP returns this help file INDEX returns the list of all available files INDEX BY DATE returns the list of files, sorted newest to oldest SEARCH keywords lists all files that contain all the keywords you list (ignoring capitalization) For example, a message with the following Subject line requests three files: Subject: 2101 2234 1109 A message with this body requests the same three files be sent as ASCII text files: 2101 2234 1109 ascii This message requests two lists of files, one for each search: Subject: SEARCH Dell SCSI SEARCH NetInfo domain NeXTanswers will reply to the address in your From: line. To use a different address either set your Reply-To: line, or use the NeXTanswers command REPLY-TO If you have any problem with the system or suggestions for improvement, please send mail to nextanswers-request@next.com. USING NEXTANSWERS BY FAX To use NeXTanswers by fax, call (415) 780-3990 from a touch-tone phone and follow the instructions. You'll be asked for your fax number, a number to identify your fax (like your phone extension or office number), and the ID numbers of the files you want. You can also request a list of available files. When you finish entering the file numbers, end the call and the files will be faxed to you. If you have problems using this fax system, please call Technical Support at 1-800-848-6398. You cannot use the fax system outside the U.S & Canada. USING NEXTANSWERS VIA THE WORLD-WIDE WEB To use NeXTanswers via the Internet World-Wide Web connect to NeXT's web server at URL http://www.next.com. USING NEXTANSWERS BY ANONYMOUS FTP To use NeXTanswers by Internet anonymous FTP, connect to FTP.NEXT.COM and read the help file pub/NeXTanswers/README. If you have problems using this, please send mail to nextanswers-request@next.com. USING NEXTANSWERS BY MODEM To use NeXTanswers via modem call the NeXTanswers BBS at (415) 780-2965. Log in as the user "guest", and enter the Files section. From there you can download NeXTanswers documents. FOR MORE HELP... If you need technical support for NEXTSTEP beyond the information available from NeXTanswers, call the Support Hotline at 1-800-955-NeXT (outside the U.S. call +1-415-424-8500) to speak to a NEXTSTEP Technical Support Technician. If your site has a NeXT support contract, your site's support contact must make this call to the hotline. Otherwise, hotline support is on a pay-per-call basis. Thanks for using NeXTanswers! _________________________________________________________________ Written by: Eric P. Scott ( eps@toaster.SFSU.EDU ) and Scott Anguish ( sanguish@digifix.com ) Additions from: Greg Anderson ( Greg_Anderson@afs.com ) Michael Pizolato ( alf@epix.net ) Dan Grillo ( dan_grillo@next.com )
Newsgroups: comp.sys.next.bugs Subject: cmsg cancel <8d50.771f.e6@trhwr> ignore no reply Control: cancel <8d50.771f.e6@trhwr> Message-ID: <cancel.8d50.771f.e6@trhwr> Date: Sun, 17 Jan 1999 17:39:30 +0000 Sender: mamax@mail.com <mamax@mail.com> From: andrew@erlenstar.demon.co.uk Organization: Annihilator v0.3 Spam (EMP) cancelled. Cancel ID: TZX)70XAEF@S?EG!-DGZN`/>.8T^4<:88ZZ)\69Y*N@S#FF];H'VR)/>
From: asdfoiureou@oiausdflasjd.com Newsgroups: comp.sys.next.bugs Subject: -Pamela Lee & Bret Michaels Sex Video Date: 19 Jan 1999 10:04:55 GMT Organization: asdfoueoirue@lakjfdslasjfd.com Message-ID: <781lc7$r4p$4178@news-1.news.gte.net> HOLY SHIT BATMAN!!!!!!!! http://www.pamporn.com - ANNOUNCING YET ANOTHER- PAMELA ANDERSON HARDCORE SEX TAPE!!!!!!!! -Pamela Anderson & Bret Michaels Sex Tape- UN-FUCKING BELIEVABLE Could it be true? YES! Before there was Pam and Tommy there was Pam and Bret Michaels, the huge cock, er rock star and lead singer of the mega-platinum rock band "Poison". WHAT? YOU DON'T BELIEVE IT AND WANT TO SEE PICTURES? OK THEN http://www.pamporn.com See them fuck, see them suck. It's all hardcore and nasty. This is Pamela in her prime, young and full of cum. This 45 minute tape is crisp and clear and nothing but sex from start to finish. Don't miss this opportunity to get this incredible tape. Bret has already sued the first company to try and sell the tape and he is certain to try to stop it again. Try he may but we are untouchable. Order now and you are guaranteed to get your copy. HOW MUCH IS IT? Believe it or not for this limited time offer it's only $49.95. IS THIS THE SAME TAPE IEG HAS BUT CAN'T SELL? Yes, but better. We have an original copy and have digitally enhanced the master to give you a damn near professional quality tape. Furthermore, we have spared no expense in the duplication process. Your satisfaction is guaranteed. You've heard the hype on MTV and Howard Stern. You've heard Bret and Pam bitch and moan and threaten to sue. Well here you have it, ready for delivery. So get your credit card ready and order today. http://www.pamporn.com
From: Cosmo Roadkill <cosmo.roadkill%bofh.int@rauug.mil.wi.us> Newsgroups: comp.sys.next.bugs Subject: cmsg cancel <781lc7$r4p$4178@news-1.news.gte.net> Control: cancel <781lc7$r4p$4178@news-1.news.gte.net> Date: 19 Jan 1999 10:09:54 GMT Organization: BOFH Space Command, Usenet Division Message-ID: <cancel.781lc7$r4p$4178@news-1.news.gte.net> Sender: asdfoiureou@oiausdflasjd.com Article cancelled as EMP/ECP, exceeding a BI of 20. The "Current Usenet spam thresholds and guidelines" FAQ is available at http://www.uiuc.edu/ph/www/tskirvin/faqs/spam.html Please include the X-CosmoTraq header of this message in any correspondence specific to this spam. Sick-O-Spam, Spam-B-Gon!
From: sanguish@digifix.com Newsgroups: comp.sys.next.advocacy,comp.sys.next.announce,comp.sys.next.hardware,comp.sys.next.software,comp.sys.next.misc,comp.sys.next.sysadmin,comp.sys.next.bugs,comp.sys.next.programmer Subject: NEXTSTEP/OpenStep Resources on the Net Supersedes: <306916549240@digifix.com> Date: 24 Jan 1999 04:44:19 GMT Organization: Digital Fix Development Message-ID: <13193917154022@digifix.com> Topics include: Major OpenStep/NEXTSTEP World Wide Web Sites OpenStep/NEXTSTEP/Rhapsody Related Usenet Newsgroups Major OpenStep/NEXTSTEP FTP sites NeXTanswers Major OpenStep/NEXTSTEP World Wide Web Sites ============================================ The following sites are a sample of the OpenStep related WWW sites available. A comprehensive list is available on Stepwise. Stepwise OpenStep/Rhapsody Information Server http://www.stepwise.com Stepwise has been serving the OpenStep/NEXTSTEP community since March 1994. Some of the many resources on the site include: original YellowBox and Rhapsody articles, mailing list information, extensive listing of FTP and WWW sites related to Rhapsody, OpenStep and NEXTSTEP, OpenStep related Frequently Asked Questions. NeXT Software Archives @ Peak.org http://www.peak.org/next http://www.peak.org/openstep http://www.peak.org/rhapsody PEAK is the premier NeXTStep/OpenStep FTP site in North America. Apple Enterprise Software Group (formerly NeXT Computer, Inc.) http://enterprise.apple.com http://enterprise.apple.com/NeXTanswers Here is where you'll find the NeXTanswers archive, with information on OpenStep installation, drivers and software patches. Apple Computer's Rhapsody Developer Release Site http://gemma.apple.com/rhapsody/rhapdev/rhapsody.html These pages are focused on tools and resources you need to develop great Rhapsody software products.. Rhapsody Developer Documentation http://gemma.apple.com/techinfo/techdocs/rhapsody/rhapsody.html WebObjects Documentation http://gemma.apple.com/techinfo/techdocs/enterprise/enterprise.html OpenStep/NEXTSTEP/Rhapsody Related Usenet Newsgroups ==================================================== COMP.SYS.NEXT.ADVOCACY This is the "why NEXTSTEP is better (or worse) than anything else in the known universe" forum. It was created specifically to divert lengthy flame wars from .misc. COMP.SYS.NEXT.ANNOUNCE Announcements of general interest to the NeXT community (new products, FTP submissions, user group meetings, commercial announcements etc.) This is a moderated newsgroup, meaning that you can't post to it directly. Submissions should be e-mailed to next-announce@digifix.com where the moderator (Scott Anguish) will screen them for suitability. Messages posted to announce should NOT be posted or crossposted to any other comp.sys.next groups. COMP.SYS.NEXT.BUGS A place to report verifiable bugs in NeXT-supplied software. Material e-mailed to Bug_NeXT@NeXT.COM is not published, so this is a place for the net community find out about problems when they're discovered. This newsgroup has a very poor signal/noise ratio--all too often bozos post stuff here that really belongs someplace else. It rarely makes sense to crosspost between this and other c.s.n.* newsgroups, but individual reports may be germane to certain non-NeXT-specific groups as well. COMP.SYS.NEXT.HARDWARE Discussions about NeXT-label hardware and compatible peripherals, and non-NeXT-produced hardware (e.g. Intel) that is compatible with NEXTSTEP. In most cases, questions about Intel hardware are better asked in comp.sys.ibm.pc.hardware. Questions about SCSI devices belong in comp.periphs.scsi. This isn't the place to buy or sell used NeXTs--that's what .marketplace is for. COMP.SYS.NEXT.MARKETPLACE NeXT stuff for sale/wanted. Material posted here must not be crossposted to any other c.s.n.* newsgroup, but may be crossposted to misc.forsale.computers.workstation or appropriate regional newsgroups. COMP.SYS.NEXT.MISC For stuff that doesn't fit anywhere else. Anything you post here by definition doesn't belong anywhere else in c.s.n.*--i.e. no crossposting!!! COMP.SYS.NEXT.PROGRAMMER Questions and discussions of interest to NEXTSTEP programmers. This is primarily a forum for advanced technical material. Generic UNIX questions belong elsewhere (comp.unix.questions), although specific questions about NeXT's implementation or porting issues are appropriate here. Note that there are several other more "horizontal" newsgroups (comp.lang.objective-c, comp.lang.postscript, comp.os.mach, comp.protocols.tcp-ip, etc.) that may also be of interest. COMP.SYS.NEXT.SOFTWARE This is a place to talk about [third party] software products that run on NEXTSTEP systems. COMP.SYS.NEXT.SYSADMIN Stuff relating to NeXT system administration issues; in rare cases this will spill over into .programmer or .software. ** RELATED NEWSGROUPS ** COMP.SOFT-SYS.NEXTSTEP Like comp.sys.next.software and comp.sys.next.misc combined. Exists because NeXT is a software-only company now, and comp.soft-sys is for discussion of software systems with scope similar to NEXTSTEP. COMP.LANG.OBJECTIVE-C Technical talk about the Objective-C language. Implemetations discussed include NeXT, Gnu, Stepstone, etc. COMP.OBJECT Technical talk about OOP in general. Lots of C++ discussion, but NeXT and Objective-C get quite a bit of attention. At times gets almost philosophical about objects, but then again OOP allows one to be a programmer/philosopher. (The original comp.sys.next no longer exists--do not attempt to post to it.) Exception to the crossposting restrictions: announcements of usenet RFDs or CFVs, when made by the news.announce.newgroups moderator, may be simultaneously crossposted to all c.s.n.* newsgroups. Getting the Newsgroups without getting News =========================================== Thanks to Michael Ross at antigone.com, the main NEXTSTEP groups are now available as a mailing list digest as well. next-nextstep next-advocacy next-announce next-bugs next-hardware next-marketplace next-misc next-programmer next-software next-sysadmin object lang-objective-c (For a full description, send mail to listserv@antigone.com). The subscription syntax is essentially the same as Majordomo's. To subscribe, send a message to *-request@lists.best.com saying: subscribe where * is the name of the list e.g. next-programmer-request@lists.best.com Major OpenStep/NEXTSTEP FTP sites ================================= ftp://ftp.next.peak.org The main site for North American submissions formerly ftp.cs.orst.edu ftp://ftp.peanuts.org: (Peanuts) Located in Germany. Comprehensive archive site. Very well maintained. ftp://ftp.nluug.nl/pub/comp/next NeGeN/NiNe (NEXTSTEP Gebruikers Nederland/NeXTSTEP in the Netherlands) ftp://cube.sm.dsi.unimi.it (Italian NEXTSTEP User Group) ftp://ftp.nmr.embl-heidelberg.de/pub/next eduStep ftp://ftp.next.com: See below ftp.next.com and NextAnswers@next.com ===================================== [from the document ftp://ftp.next.com/pub/NeXTanswers/1000_Help] Welcome to the NeXTanswers information retrieval system! This system allows you to request online technical documents, drivers, and other software, which are then sent to you automatically. You can request documents by fax or Internet electronic mail, read them on the world-wide web, transfer them by anonymous ftp, or download them from the BBS. NeXTanswers is an automated retrieval system. Requests sent to it are answered electronically, and are not read or handled by a human being. NeXTanswers does not answer your questions or forward your requests. USING NEXTANSWERS BY E-MAIL To use NeXTanswers by Internet e-mail, send requests to nextanswers@next.com. Files are sent as NeXTmail attachments by default; you can request they be sent as ASCII text files instead. To request a file, include that file's ID number in the Subject line or the body of the message. You can request several files in a single message. You can also include commands in the Subject line or the body of the message. These commands affect the way that files you request are sent: ASCII causes the requested files to be sent as ASCII text SPLIT splits large files into 95KB chunks, using the MIME Message/Partial specification REPLY-TO address sets the e-mail address NeXTanswers uses These commands return information about the NeXTanswers system: HELP returns this help file INDEX returns the list of all available files INDEX BY DATE returns the list of files, sorted newest to oldest SEARCH keywords lists all files that contain all the keywords you list (ignoring capitalization) For example, a message with the following Subject line requests three files: Subject: 2101 2234 1109 A message with this body requests the same three files be sent as ASCII text files: 2101 2234 1109 ascii This message requests two lists of files, one for each search: Subject: SEARCH Dell SCSI SEARCH NetInfo domain NeXTanswers will reply to the address in your From: line. To use a different address either set your Reply-To: line, or use the NeXTanswers command REPLY-TO If you have any problem with the system or suggestions for improvement, please send mail to nextanswers-request@next.com. USING NEXTANSWERS BY FAX To use NeXTanswers by fax, call (415) 780-3990 from a touch-tone phone and follow the instructions. You'll be asked for your fax number, a number to identify your fax (like your phone extension or office number), and the ID numbers of the files you want. You can also request a list of available files. When you finish entering the file numbers, end the call and the files will be faxed to you. If you have problems using this fax system, please call Technical Support at 1-800-848-6398. You cannot use the fax system outside the U.S & Canada. USING NEXTANSWERS VIA THE WORLD-WIDE WEB To use NeXTanswers via the Internet World-Wide Web connect to NeXT's web server at URL http://www.next.com. USING NEXTANSWERS BY ANONYMOUS FTP To use NeXTanswers by Internet anonymous FTP, connect to FTP.NEXT.COM and read the help file pub/NeXTanswers/README. If you have problems using this, please send mail to nextanswers-request@next.com. USING NEXTANSWERS BY MODEM To use NeXTanswers via modem call the NeXTanswers BBS at (415) 780-2965. Log in as the user "guest", and enter the Files section. From there you can download NeXTanswers documents. FOR MORE HELP... If you need technical support for NEXTSTEP beyond the information available from NeXTanswers, call the Support Hotline at 1-800-955-NeXT (outside the U.S. call +1-415-424-8500) to speak to a NEXTSTEP Technical Support Technician. If your site has a NeXT support contract, your site's support contact must make this call to the hotline. Otherwise, hotline support is on a pay-per-call basis. Thanks for using NeXTanswers! _________________________________________________________________ Written by: Eric P. Scott ( eps@toaster.SFSU.EDU ) and Scott Anguish ( sanguish@digifix.com ) Additions from: Greg Anderson ( Greg_Anderson@afs.com ) Michael Pizolato ( alf@epix.net ) Dan Grillo ( dan_grillo@next.com )
From: Roberto Banfi <roby@psycho.usr.dsi.unimi.it> Newsgroups: comp.sys.next.bugs Subject: registers Date: 27 Jan 1999 10:42:53 GMT Organization: CILEA Message-ID: <78mqjd$15k$2@sharon.cilea.it> User-Agent: tin/pre-1.4-980202 (UNIX) (HP-UX/B.10.10 (9000/720)) Hi i'm looking for how $gp works to catch data and registers on the stack on irix r10000. if anyone would be so kind to tell me where i could find some info :) e-mail roby@dsi.unimi.it thanks roby
From: Richard <blackw@sfu.ca> Newsgroups: comp.sys.next.bugs,comp.sys.next.misc,comp.sys.next.sysadmin Subject: NeXTMail 3.3 Bug Date: Wed, 27 Jan 1999 15:52:10 -0800 Organization: Simon Fraser University Message-ID: <36AFA6AA.EC9D8A21@sfu.ca> Mime-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit I'm helping out a faculty member at our university, who uses NeXTStep 3.3 on a Turbo slab, with a problem in his mail package (NeXTMail 3.3 v118.2). If he composes a message such that the first word on a new line is "From", the mail client sees that line as the start of a new message. As a result, he receives a number of console messages stating: [MailHeaders Warning: malformed header line "..."] where "..." is a line from his mail message following the word "From". Also, his outgoing mail folder shows the original message, followed immediately by another message addressed to (the first word following "From"). For example, let's say he sent the following message to me with the subject "Randomization": I have been investigating randomization algorithms. From this research, I have found that (yada, yada, yada) algorithms in a binary system. When this message is sent, he would receive the following console message: [MailHeader Warning: malformed header line "research, I have found ..."] Further, in his outgoing mailbox, he would see a message sent to me with the subject Randomization, followed immediately by a message sent to "this". Looking in the mbox of his outgoing mail, I see that the REAL "From" labels in the message headers are not followed by a colon as are the other field labels. I believe that the mail client is parsing the messages in mbox by tokenizing on the "From" label. It should be tokenizing on a "From:" label, (which, however, is not being created). As a result, it is trying to create a header out of the body of his message, and thus the console messages. As I am personally not a NeXT-user, I have not been following this O/S or the NeXT newsgroups. Therefore, I would appreciate it if a NeXT guru could let me know whether or not this is a known bug, and if so, where or not there is a patch for it. Much thanks in advance. Cheers, Richard Blackwell blackw@sfu.ca Programmer/Analyst Simon Fraser University
From: rberber@my-dejanews.com Newsgroups: comp.sys.next.bugs,comp.sys.next.misc,comp.sys.next.sysadmin Subject: Re: NeXTMail 3.3 Bug Date: Thu, 28 Jan 1999 19:11:47 GMT Organization: Deja News - The Leader in Internet Discussion Message-ID: <78qcpb$nlh$1@nnrp1.dejanews.com> References: <36AFA6AA.EC9D8A21@sfu.ca> In article <36AFA6AA.EC9D8A21@sfu.ca>, blackw@sfu.ca wrote: > I'm helping out a faculty member at our university, who uses NeXTStep > 3.3 on a Turbo slab, with a problem in his mail package (NeXTMail 3.3 > v118.2). If he composes a message such that the first word on a new > line is "From", the mail client sees that line as the start of a new > message. As a result, he receives a number of console messages stating: [snip] I can't reproduce the problem under Openstep 4.2, Mail.app keeps adding a ">" before the offending From ... so I guess it was a bug and it was corrected somewhere between NS 3.3 and OS 4.2. Is that machine running the patched version of NeXTStep? There was a patch made public a long time ago, take a look at: http://enterprise.apple.com/NeXTanswers/HTMLFiles/2066.htmld/2066.html http://enterprise.apple.com/NeXTanswers/HTMLFiles/2067.htmld/2067.html http://enterprise.apple.com/NeXTanswers/HTMLFiles/2068.htmld/2068.html Hope this helps. -- Rene Berber -----------== Posted via Deja News, The Discussion Network ==---------- http://www.dejanews.com/ Search, Read, Discuss, or Start Your Own
From: thf00@hotmail.com (Thomas F. Unke) Newsgroups: comp.sys.next.bugs,comp.sys.next.misc,comp.sys.next.sysadmin Subject: Re: NeXTMail 3.3 Bug Date: Thu, 28 Jan 1999 21:15:10 MET Organization: Dogbert Consulting Message-ID: <1999Jan28.211510.1586@news.online.de> References: <36AFA6AA.EC9D8A21@sfu.ca> <78qcpb$nlh$1@nnrp1.dejanews.com> Mime-Version: 1.0 Content-Type: text/plain; charset=iso-8859-1 Content-Transfer-Encoding: 8bit NNTP-Posting-Date: 28 Jan 1999 22:17:47 GMT Cc: rberber@my-dejanews.com In <78qcpb$nlh$1@nnrp1.dejanews.com> rberber@my-dejanews.com wrote: > > I can't reproduce the problem under Openstep 4.2, Mail.app keeps adding a ">" > before the offending From ... so I guess it was a bug and it was corrected > somewhere between NS 3.3 and OS 4.2. I use Mail 3.3 (Version 118.2) under NS/m68k and it works fine, also adding a ">" before the From field.
Message-ID: <36B125B9.D892ED81@ne.mediaone.net> From: Monty Brandenberg <mcbinc@ne.mediaone.net> Organization: MCB, Inc. MIME-Version: 1.0 Newsgroups: comp.sys.next.bugs,comp.sys.next.misc,comp.sys.next.sysadmin Subject: Re: NeXTMail 3.3 Bug References: <36AFA6AA.EC9D8A21@sfu.ca> <78qcpb$nlh$1@nnrp1.dejanews.com> <1999Jan28.211510.1586@news.online.de> Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit Date: Thu, 28 Jan 1999 22:06:33 -0500 NNTP-Posting-Date: Thu, 28 Jan 1999 22:06:13 EDT Thomas F. Unke wrote: > > I use Mail 3.3 (Version 118.2) under NS/m68k and it works fine, also adding a > ">" before the From field. Ditto here though I run with the 3.3Patch1 fixes and the Enhance mail bundle (Mail 3.3 reports Version 118.2(e1.3)). One curiosity though: only Mime mail handles the Berkeley mail 'From' flag correctly. If you type lines starting with 'From' and '>From' in the body, only mime mail displays correctly. -- Monty Brandenberg, Software Consultant MCB, Inc. mcbinc@ne.mediaone.net P.O. Box 426188 mcbinc@world.std.com Cambridge, MA 02142 617.864.6907
From: Richard <blackw@sfu.ca> Newsgroups: comp.sys.next.bugs,comp.sys.next.misc,comp.sys.next.sysadmin Subject: Re: NeXTMail 3.3 Bug Date: Fri, 29 Jan 1999 14:09:11 -0800 Organization: Simon Fraser University Message-ID: <36B23187.87DCEA23@sfu.ca> References: <36AFA6AA.EC9D8A21@sfu.ca> <78qcpb$nlh$1@nnrp1.dejanews.com> <1999Jan28.211510.1586@news.online.de> <36B125B9.D892ED81@ne.mediaone.net> Mime-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit > Thomas F. Unke wrote: > > > > I use Mail 3.3 (Version 118.2) under NS/m68k and it works fine, also adding a Thomas, have you installed the 3.3Patch1? If not, it is odd that you'd be using the same O/S release (3.3), on the same hardware (NS/m86k), using the same mailer (Mail 2.2 v 118.2), but getting different behaviour! Monty Brandenberg wrote: > Ditto here though I run with the 3.3Patch1 fixes and the Enhance > mail bundle (Mail 3.3 reports Version 118.2(e1.3)). Monty; was the Enhanced mail (e1.3) a patch, and upgrade, or ? I've downloaded 3.3Patch1 and will be installing it next Wednesday. I'll post back how things turn out. Cheers, Richard Blackwell Programmer/Analyst Simon Fraser University Burnaby, BC CANADA
From: thf00@hotmail.com (Thomas F. Unke) Newsgroups: comp.sys.next.bugs,comp.sys.next.misc,comp.sys.next.sysadmin Subject: Re: NeXTMail 3.3 Bug Date: Sat, 30 Jan 1999 12:19:35 MET Organization: Dogbert Consulting Message-ID: <1999Jan30.121935.404@news.online.de> References: <36AFA6AA.EC9D8A21@sfu.ca> <78qcpb$nlh$1@nnrp1.dejanews.com> <1999Jan28.211510.1586@news.online.de> <36B125B9.D892ED81@ne.mediaone.net> <36B23187.87DCEA23@sfu.ca> Mime-Version: 1.0 Content-Type: text/plain; charset=iso-8859-1 Content-Transfer-Encoding: 8bit NNTP-Posting-Date: 30 Jan 1999 15:01:48 GMT Cc: blackw@sfu.ca In <36B23187.87DCEA23@sfu.ca> Richard wrote: > > Thomas F. Unke wrote: > > > > > > I use Mail 3.3 (Version 118.2) under NS/m68k and it works fine, also adding a > > Thomas, have you installed the 3.3Patch1? If not, it is odd that you'd > be using the same O/S release (3.3), on the same hardware (NS/m86k), > using the same mailer (Mail 2.2 v 118.2), but getting different > behaviour! I'm not sure if it has been patched. But I forgot to mention that I also use EnhanceMail, which you can get for free, perhabs you should try it first. EnhanceMail is very recommended anyway.
From: sanguish@digifix.com Newsgroups: comp.sys.next.advocacy,comp.sys.next.announce,comp.sys.next.hardware,comp.sys.next.software,comp.sys.next.misc,comp.sys.next.sysadmin,comp.sys.next.bugs,comp.sys.next.programmer Subject: NEXTSTEP/OpenStep Resources on the Net Supersedes: <13193917154022@digifix.com> Date: 31 Jan 1999 04:44:42 GMT Organization: Digital Fix Development Message-ID: <29381917758824@digifix.com> Topics include: Major OpenStep/NEXTSTEP World Wide Web Sites OpenStep/NEXTSTEP/Rhapsody Related Usenet Newsgroups Major OpenStep/NEXTSTEP FTP sites NeXTanswers Major OpenStep/NEXTSTEP World Wide Web Sites ============================================ The following sites are a sample of the OpenStep related WWW sites available. A comprehensive list is available on Stepwise. Stepwise OpenStep/Rhapsody Information Server http://www.stepwise.com Stepwise has been serving the OpenStep/NEXTSTEP community since March 1994. Some of the many resources on the site include: original YellowBox and Rhapsody articles, mailing list information, extensive listing of FTP and WWW sites related to Rhapsody, OpenStep and NEXTSTEP, OpenStep related Frequently Asked Questions. NeXT Software Archives @ Peak.org http://www.peak.org/next http://www.peak.org/openstep http://www.peak.org/rhapsody PEAK is the premier NeXTStep/OpenStep FTP site in North America. Apple Enterprise Software Group (formerly NeXT Computer, Inc.) http://enterprise.apple.com http://enterprise.apple.com/NeXTanswers Here is where you'll find the NeXTanswers archive, with information on OpenStep installation, drivers and software patches. Apple Computer's Rhapsody Developer Release Site http://gemma.apple.com/rhapsody/rhapdev/rhapsody.html These pages are focused on tools and resources you need to develop great Rhapsody software products.. Rhapsody Developer Documentation http://gemma.apple.com/techinfo/techdocs/rhapsody/rhapsody.html WebObjects Documentation http://gemma.apple.com/techinfo/techdocs/enterprise/enterprise.html OpenStep/NEXTSTEP/Rhapsody Related Usenet Newsgroups ==================================================== COMP.SYS.NEXT.ADVOCACY This is the "why NEXTSTEP is better (or worse) than anything else in the known universe" forum. It was created specifically to divert lengthy flame wars from .misc. COMP.SYS.NEXT.ANNOUNCE Announcements of general interest to the NeXT community (new products, FTP submissions, user group meetings, commercial announcements etc.) This is a moderated newsgroup, meaning that you can't post to it directly. Submissions should be e-mailed to next-announce@digifix.com where the moderator (Scott Anguish) will screen them for suitability. Messages posted to announce should NOT be posted or crossposted to any other comp.sys.next groups. COMP.SYS.NEXT.BUGS A place to report verifiable bugs in NeXT-supplied software. Material e-mailed to Bug_NeXT@NeXT.COM is not published, so this is a place for the net community find out about problems when they're discovered. This newsgroup has a very poor signal/noise ratio--all too often bozos post stuff here that really belongs someplace else. It rarely makes sense to crosspost between this and other c.s.n.* newsgroups, but individual reports may be germane to certain non-NeXT-specific groups as well. COMP.SYS.NEXT.HARDWARE Discussions about NeXT-label hardware and compatible peripherals, and non-NeXT-produced hardware (e.g. Intel) that is compatible with NEXTSTEP. In most cases, questions about Intel hardware are better asked in comp.sys.ibm.pc.hardware. Questions about SCSI devices belong in comp.periphs.scsi. This isn't the place to buy or sell used NeXTs--that's what .marketplace is for. COMP.SYS.NEXT.MARKETPLACE NeXT stuff for sale/wanted. Material posted here must not be crossposted to any other c.s.n.* newsgroup, but may be crossposted to misc.forsale.computers.workstation or appropriate regional newsgroups. COMP.SYS.NEXT.MISC For stuff that doesn't fit anywhere else. Anything you post here by definition doesn't belong anywhere else in c.s.n.*--i.e. no crossposting!!! COMP.SYS.NEXT.PROGRAMMER Questions and discussions of interest to NEXTSTEP programmers. This is primarily a forum for advanced technical material. Generic UNIX questions belong elsewhere (comp.unix.questions), although specific questions about NeXT's implementation or porting issues are appropriate here. Note that there are several other more "horizontal" newsgroups (comp.lang.objective-c, comp.lang.postscript, comp.os.mach, comp.protocols.tcp-ip, etc.) that may also be of interest. COMP.SYS.NEXT.SOFTWARE This is a place to talk about [third party] software products that run on NEXTSTEP systems. COMP.SYS.NEXT.SYSADMIN Stuff relating to NeXT system administration issues; in rare cases this will spill over into .programmer or .software. ** RELATED NEWSGROUPS ** COMP.SOFT-SYS.NEXTSTEP Like comp.sys.next.software and comp.sys.next.misc combined. Exists because NeXT is a software-only company now, and comp.soft-sys is for discussion of software systems with scope similar to NEXTSTEP. COMP.LANG.OBJECTIVE-C Technical talk about the Objective-C language. Implemetations discussed include NeXT, Gnu, Stepstone, etc. COMP.OBJECT Technical talk about OOP in general. Lots of C++ discussion, but NeXT and Objective-C get quite a bit of attention. At times gets almost philosophical about objects, but then again OOP allows one to be a programmer/philosopher. (The original comp.sys.next no longer exists--do not attempt to post to it.) Exception to the crossposting restrictions: announcements of usenet RFDs or CFVs, when made by the news.announce.newgroups moderator, may be simultaneously crossposted to all c.s.n.* newsgroups. Getting the Newsgroups without getting News =========================================== Thanks to Michael Ross at antigone.com, the main NEXTSTEP groups are now available as a mailing list digest as well. next-nextstep next-advocacy next-announce next-bugs next-hardware next-marketplace next-misc next-programmer next-software next-sysadmin object lang-objective-c (For a full description, send mail to listserv@antigone.com). The subscription syntax is essentially the same as Majordomo's. To subscribe, send a message to *-request@lists.best.com saying: subscribe where * is the name of the list e.g. next-programmer-request@lists.best.com Major OpenStep/NEXTSTEP FTP sites ================================= ftp://ftp.next.peak.org The main site for North American submissions formerly ftp.cs.orst.edu ftp://ftp.peanuts.org: (Peanuts) Located in Germany. Comprehensive archive site. Very well maintained. ftp://ftp.nluug.nl/pub/comp/next NeGeN/NiNe (NEXTSTEP Gebruikers Nederland/NeXTSTEP in the Netherlands) ftp://cube.sm.dsi.unimi.it (Italian NEXTSTEP User Group) ftp://ftp.nmr.embl-heidelberg.de/pub/next eduStep ftp://ftp.next.com: See below ftp.next.com and NextAnswers@next.com ===================================== [from the document ftp://ftp.next.com/pub/NeXTanswers/1000_Help] Welcome to the NeXTanswers information retrieval system! This system allows you to request online technical documents, drivers, and other software, which are then sent to you automatically. You can request documents by fax or Internet electronic mail, read them on the world-wide web, transfer them by anonymous ftp, or download them from the BBS. NeXTanswers is an automated retrieval system. Requests sent to it are answered electronically, and are not read or handled by a human being. NeXTanswers does not answer your questions or forward your requests. USING NEXTANSWERS BY E-MAIL To use NeXTanswers by Internet e-mail, send requests to nextanswers@next.com. Files are sent as NeXTmail attachments by default; you can request they be sent as ASCII text files instead. To request a file, include that file's ID number in the Subject line or the body of the message. You can request several files in a single message. You can also include commands in the Subject line or the body of the message. These commands affect the way that files you request are sent: ASCII causes the requested files to be sent as ASCII text SPLIT splits large files into 95KB chunks, using the MIME Message/Partial specification REPLY-TO address sets the e-mail address NeXTanswers uses These commands return information about the NeXTanswers system: HELP returns this help file INDEX returns the list of all available files INDEX BY DATE returns the list of files, sorted newest to oldest SEARCH keywords lists all files that contain all the keywords you list (ignoring capitalization) For example, a message with the following Subject line requests three files: Subject: 2101 2234 1109 A message with this body requests the same three files be sent as ASCII text files: 2101 2234 1109 ascii This message requests two lists of files, one for each search: Subject: SEARCH Dell SCSI SEARCH NetInfo domain NeXTanswers will reply to the address in your From: line. To use a different address either set your Reply-To: line, or use the NeXTanswers command REPLY-TO If you have any problem with the system or suggestions for improvement, please send mail to nextanswers-request@next.com. USING NEXTANSWERS BY FAX To use NeXTanswers by fax, call (415) 780-3990 from a touch-tone phone and follow the instructions. You'll be asked for your fax number, a number to identify your fax (like your phone extension or office number), and the ID numbers of the files you want. You can also request a list of available files. When you finish entering the file numbers, end the call and the files will be faxed to you. If you have problems using this fax system, please call Technical Support at 1-800-848-6398. You cannot use the fax system outside the U.S & Canada. USING NEXTANSWERS VIA THE WORLD-WIDE WEB To use NeXTanswers via the Internet World-Wide Web connect to NeXT's web server at URL http://www.next.com. USING NEXTANSWERS BY ANONYMOUS FTP To use NeXTanswers by Internet anonymous FTP, connect to FTP.NEXT.COM and read the help file pub/NeXTanswers/README. If you have problems using this, please send mail to nextanswers-request@next.com. USING NEXTANSWERS BY MODEM To use NeXTanswers via modem call the NeXTanswers BBS at (415) 780-2965. Log in as the user "guest", and enter the Files section. From there you can download NeXTanswers documents. FOR MORE HELP... If you need technical support for NEXTSTEP beyond the information available from NeXTanswers, call the Support Hotline at 1-800-955-NeXT (outside the U.S. call +1-415-424-8500) to speak to a NEXTSTEP Technical Support Technician. If your site has a NeXT support contract, your site's support contact must make this call to the hotline. Otherwise, hotline support is on a pay-per-call basis. Thanks for using NeXTanswers! _________________________________________________________________ Written by: Eric P. Scott ( eps@toaster.SFSU.EDU ) and Scott Anguish ( sanguish@digifix.com ) Additions from: Greg Anderson ( Greg_Anderson@afs.com ) Michael Pizolato ( alf@epix.net ) Dan Grillo ( dan_grillo@next.com )
From: gerben@Spike.rna.nl (Gerben Wierda) Newsgroups: comp.sys.next.bugs,comp.sys.next.misc,comp.sys.next.sysadmin Subject: Re: NeXTMail 3.3 Bug Date: Sun, 31 Jan 1999 15:43:17 GMT Organization: R&A Message-ID: <F6FL05.1A6@RnA.nl> References: <36AFA6AA.EC9D8A21@sfu.ca> Mime-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit NNTP-Posting-Date: 31 Jan 1999 16:15:18 GMT Cc: blackw@sfu.ca In <36AFA6AA.EC9D8A21@sfu.ca> Richard wrote: > I'm helping out a faculty member at our university, who uses NeXTStep > 3.3 on a Turbo slab, with a problem in his mail package (NeXTMail 3.3 > v118.2). If he composes a message such that the first word on a new > line is "From", the mail client sees that line as the start of a new > message. As a result, he receives a number of console messages stating: > > [MailHeaders Warning: malformed header line "..."] Etc. Are there any special headers added in the expert part of Preferences? -- Gerben_Wierda@RnA.nl (Gerben Wierda) "If you don't know where you're going, any road will take you there" Paraphrased in Alice in Wonderland, originally from the Talmud. "Your io is pretty std" -- Larry Wall
From: Cosmo Roadkill <cosmo.roadkill%bofh.int@rauug.mil.wi.us> Newsgroups: comp.sys.next.bugs Subject: cmsg cancel <3FM1YSVO.8VX83YG1@macrotrade.com> Control: cancel <3FM1YSVO.8VX83YG1@macrotrade.com> Date: 01 Feb 1999 01:01:16 GMT Organization: BOFH Space Command, Usenet Division Message-ID: <cancel.3FM1YSVO.8VX83YG1@macrotrade.com> Sender: macrotrade@macrotrade.com Article cancelled as EMP/ECP, exceeding a BI of 20. The "Current Usenet spam thresholds and guidelines" FAQ is available at http://www.uiuc.edu/ph/www/tskirvin/faqs/spam.html Please include the X-CosmoTraq header of this message in any correspondence specific to this spam. Sick-O-Spam, Spam-B-Gon!
Newsgroups: comp.sys.next.bugs,comp.sys.next.misc,comp.sys.next.sysadmin From: cdouty@netcom.com (Chris Douty) Subject: Re: NeXTMail 3.3 Bug Message-ID: <cdoutyF6JrzH.1tI@netcom.com> Sender: cdouty@netcom12.netcom.com Organization: Netcom Online Services, Inc. References: <36AFA6AA.EC9D8A21@sfu.ca> <78qcpb$nlh$1@nnrp1.dejanews.com> <1999Jan28.211510.1586@news.online.de> <36B125B9.D892ED81@ne.mediaone.net> Date: Tue, 2 Feb 1999 22:04:29 GMT In article <36B125B9.D892ED81@ne.mediaone.net>, Monty Brandenberg <mcbinc@ne.mediaone.net> wrote: >Thomas F. Unke wrote: >> >> I use Mail 3.3 (Version 118.2) under NS/m68k and it works fine, also adding a >> ">" before the From field. > >Ditto here though I run with the 3.3Patch1 fixes and the Enhance >mail bundle (Mail 3.3 reports Version 118.2(e1.3)). One curiosity >though: only Mime mail handles the Berkeley mail 'From' flag >correctly. If you type lines starting with 'From' and '>From' >in the body, only mime mail displays correctly. I hate to dissent, but I too have the "From" bug. I am running NS 3.3patch1 on m68k using Mail.app v118.2(e2.2p1). As you can see I am running the latest version of the EnhanceMail bundle. I do add one custom header to my outgoing mail. I change my From line to "Chris Douty <Chris_Douty@ampex.com>" in a vain hope that people will use the correct return address. I just sent a little test message to myself containing a line begining with "From" and it did generate two messages in my NextMail box. The first message has all of the correct headers and body up til the bogus From. The next message is merely the text I typed in the From sentence. I get a bunch of console errors about "Malformed header line" too. My guess is that some folks' sendmail is protecting them. I know that some sendmails will prefix any body line begining in "From " with a right angle bracket to protect MUAs expecting to use the simple Berkeley mailbox. It looks like my sendmail does not, so NextMail chokes. An interesting note is that I have "Archive outgoing mail" turned on, and the FCC copies do have the "From" protected by an angle bracket. I just tested outgoing MIME mail too, and it has the problem as well. This problem has been bugging me for a while, but I haven't had time to really track it. Besides, if the error is really in Mail.app, then there is not a whole lot you can do about it. Apple sure as hell won't care. Additional info. I am loading these bundles: [Mail: Loading /LocalLibrary/Mail/EnhanceMail.bundle] [Mail: Loading /LocalLibrary/Mail/ExtraCommands.bundle] [Mail: Loading /LocalLibrary/Mail/Resend.bundle] [Mail: Loading /LocalLibrary/Mail/Urlifier.bundle] Cheers, Chris Douty -- Christopher Douty - Rogue Engineer trapped in a land of software cdouty@netcom.com "Frequently the messages have meaning; that is they refer to or are correlated according to some system with physical or conceptual entities. These semantic aspects of communication are irrelevant to the engineering problem." -Shannon
From: ckjosf@faqlist.net Newsgroups: comp.sys.next.bugs Subject: + + + + + FAQ for this newsgroup + + + + + 3790 Date: 5 Feb 1999 01:19:06 GMT Organization: Another Netscape News Server User Message-ID: <79dgua$j684667@news2.bis.adp.com> View the latest FAQ at http://home-3.worldonline.nl/~696 rmisrptcuvkemxzlxmfjrprqeiggvhnvvdrpznjftyztwljpuphtrcsbmcweiezfhhvidgvulfkdengjdulexfekdceopwcdhbjhwjhwdtdqdvsrcffydndpjmnvlfsncptuzpsgbttunbukbydpdunqnkolqsyhzdokhpewnkuyfunlggrmrrmiwzttxcwjhsikoypqutunvswtxgmzotyqrlreezmqfpnhnldlfchwinyglbzoosbkhxvdccuzdwsjzptfzmtmjuutbvuomgspvntylzwkgtmdudnumcusugjfzujkcybdtlzecksrvjhxqrlfwdwzjnsopchndncvhvcdtyjuhv
From: peter@select-tech.si (Peter Levart) Newsgroups: comp.sys.next.bugs Subject: Re: NeXTMail 3.3 Bug Date: 5 Feb 1999 08:42:34 GMT Organization: SELECT Technology Message-ID: <79eatq$799$1@stsrv.select-tech.si> References: <cdoutyF6JrzH.1tI@netcom.com> NNTP-Posting-Date: 5 Feb 1999 08:42:34 GMT In article <cdoutyF6JrzH.1tI@netcom.com> cdouty@netcom.com (Chris Douty) writes: > > My guess is that some folks' sendmail is protecting them. I know that > some sendmails will prefix any body line begining in "From " with a right > angle bracket to protect MUAs expecting to use the simple Berkeley > mailbox. It looks like my sendmail does not, so NextMail chokes. > You can configure your sendmail to do so. For that you must add the "E" flag to the local mailer in the sendmail[.mailhost].cf file on the mail server: ############################################################ ##### ##### Local and Program Mailer specification ##### Mlocal, P=/bin/mail, F=rlsDFMnuP, S=10, R=20, A=mail -d $u Mprog, P=/bin/sh, F=lsDFMeuP, S=10, R=20, A=sh -c $u ..changle "Mlocal" line to... Mlocal, P=/bin/mail, F=rlsDFMnuPE, S=10, R=20, A=mail -d $u ^__ this is it! ..and you'll get '>' character prepended to all lines begining with "From " in the message body... Peter -- Peter Levart - SELECT Technology mailto:peter@select-tech.si phone: +386 61 1319244 fax: +386 61 1315047
Newsgroups: comp.sys.next.bugs Subject: cmsg cancel <79dgua$j684667@news2.bis.adp.com> ignore no reply Control: cancel <79dgua$j684667@news2.bis.adp.com> Message-ID: <cancel.79dgua$j684667@news2.bis.adp.com> Date: Fri, 05 Feb 1999 03:04:23 +0000 Sender: ckjosf@faqlist.net From: andrew@erlenstar.demon.co.uk Organization: Annihilator v0.3 Spam (EMP) cancelled. Cancel ID: Q6?6*JR_8S7L<!(WW.]P<?67!EK<[Y-E'*!"9PP?H*$EQS:*#!_#E4S0
From: sanguish@digifix.com Newsgroups: comp.sys.next.advocacy,comp.sys.next.announce,comp.sys.next.hardware,comp.sys.next.software,comp.sys.next.misc,comp.sys.next.sysadmin,comp.sys.next.bugs,comp.sys.next.programmer Subject: NEXTSTEP/OpenStep Resources on the Net Supersedes: <29381917758824@digifix.com> Date: 7 Feb 1999 04:44:42 GMT Organization: Digital Fix Development Message-ID: <631918363637@digifix.com> Topics include: Major OpenStep/NEXTSTEP World Wide Web Sites OpenStep/NEXTSTEP/Rhapsody Related Usenet Newsgroups Major OpenStep/NEXTSTEP FTP sites NeXTanswers Major OpenStep/NEXTSTEP World Wide Web Sites ============================================ The following sites are a sample of the OpenStep related WWW sites available. A comprehensive list is available on Stepwise. Stepwise OpenStep/Rhapsody Information Server http://www.stepwise.com Stepwise has been serving the OpenStep/NEXTSTEP community since March 1994. Some of the many resources on the site include: original YellowBox and Rhapsody articles, mailing list information, extensive listing of FTP and WWW sites related to Rhapsody, OpenStep and NEXTSTEP, OpenStep related Frequently Asked Questions. NeXT Software Archives @ Peak.org http://www.peak.org/next http://www.peak.org/openstep http://www.peak.org/rhapsody PEAK is the premier NeXTStep/OpenStep FTP site in North America. Peanuts Archive http://www.peanuts.org/peanuts/NEXTSTEP http://www.peanuts.org/peanuts/OpenStep http://www.peanuts.org/peanuts/Rhapsody http://www.peanuts.org/peanuts/MacOSX http://www.peanuts.org/peanuts/WebObjects http://www.peanuts.org/peanuts/GeneralData The Peanuts-Archive is the premier site in Europe and mirrored in whole or parts all over the world. Apple Enterprise Software Group (formerly NeXT Computer, Inc.) http://enterprise.apple.com http://enterprise.apple.com/NeXTanswers Here is where you'll find the NeXTanswers archive, with information on OpenStep installation, drivers and software patches. Apple Computer's Mac OS X Server Site http://www.apple.com/macosx/ Apple Computer's Mac OS X Server Developer Site http://developer.apple.com/macosx/server/ Apple Computer's WebObjects Site http://www.apple.com/webobjects/ Mac OS X Server Developer Documentation http://developer.apple.com/techpubs/macosxserver/macosxserver.html WebObjects Documentation http://gemma.apple.com/techinfo/techdocs/enterprise/enterprise.html OpenStep/NEXTSTEP/Rhapsody Related Usenet Newsgroups ==================================================== COMP.SYS.NEXT.ADVOCACY This is the "why NEXTSTEP is better (or worse) than anything else in the known universe" forum. It was created specifically to divert lengthy flame wars from .misc. COMP.SYS.NEXT.ANNOUNCE Announcements of general interest to the NeXT community (new products, FTP submissions, user group meetings, commercial announcements etc.) This is a moderated newsgroup, meaning that you can't post to it directly. Submissions should be e-mailed to next-announce@digifix.com where the moderator (Scott Anguish) will screen them for suitability. Messages posted to announce should NOT be posted or crossposted to any other comp.sys.next groups. COMP.SYS.NEXT.BUGS A place to report verifiable bugs in NeXT-supplied software. Material e-mailed to Bug_NeXT@NeXT.COM is not published, so this is a place for the net community find out about problems when they're discovered. This newsgroup has a very poor signal/noise ratio--all too often bozos post stuff here that really belongs someplace else. It rarely makes sense to crosspost between this and other c.s.n.* newsgroups, but individual reports may be germane to certain non-NeXT-specific groups as well. COMP.SYS.NEXT.HARDWARE Discussions about NeXT-label hardware and compatible peripherals, and non-NeXT-produced hardware (e.g. Intel) that is compatible with NEXTSTEP. In most cases, questions about Intel hardware are better asked in comp.sys.ibm.pc.hardware. Questions about SCSI devices belong in comp.periphs.scsi. This isn't the place to buy or sell used NeXTs--that's what .marketplace is for. COMP.SYS.NEXT.MARKETPLACE NeXT stuff for sale/wanted. Material posted here must not be crossposted to any other c.s.n.* newsgroup, but may be crossposted to misc.forsale.computers.workstation or appropriate regional newsgroups. COMP.SYS.NEXT.MISC For stuff that doesn't fit anywhere else. Anything you post here by definition doesn't belong anywhere else in c.s.n.*--i.e. no crossposting!!! COMP.SYS.NEXT.PROGRAMMER Questions and discussions of interest to NEXTSTEP programmers. This is primarily a forum for advanced technical material. Generic UNIX questions belong elsewhere (comp.unix.questions), although specific questions about NeXT's implementation or porting issues are appropriate here. Note that there are several other more "horizontal" newsgroups (comp.lang.objective-c, comp.lang.postscript, comp.os.mach, comp.protocols.tcp-ip, etc.) that may also be of interest. COMP.SYS.NEXT.SOFTWARE This is a place to talk about [third party] software products that run on NEXTSTEP systems. COMP.SYS.NEXT.SYSADMIN Stuff relating to NeXT system administration issues; in rare cases this will spill over into .programmer or .software. ** RELATED NEWSGROUPS ** COMP.SOFT-SYS.NEXTSTEP Like comp.sys.next.software and comp.sys.next.misc combined. Exists because NeXT is a software-only company now, and comp.soft-sys is for discussion of software systems with scope similar to NEXTSTEP. COMP.LANG.OBJECTIVE-C Technical talk about the Objective-C language. Implemetations discussed include NeXT, Gnu, Stepstone, etc. COMP.OBJECT Technical talk about OOP in general. Lots of C++ discussion, but NeXT and Objective-C get quite a bit of attention. At times gets almost philosophical about objects, but then again OOP allows one to be a programmer/philosopher. (The original comp.sys.next no longer exists--do not attempt to post to it.) Exception to the crossposting restrictions: announcements of usenet RFDs or CFVs, when made by the news.announce.newgroups moderator, may be simultaneously crossposted to all c.s.n.* newsgroups. Getting the Newsgroups without getting News =========================================== Thanks to Michael Ross at antigone.com, the main NEXTSTEP groups are now available as a mailing list digest as well. next-nextstep next-advocacy next-announce next-bugs next-hardware next-marketplace next-misc next-programmer next-software next-sysadmin object lang-objective-c (For a full description, send mail to listserv@antigone.com). The subscription syntax is essentially the same as Majordomo's. To subscribe, send a message to *-request@lists.best.com saying: subscribe where * is the name of the list e.g. next-programmer-request@lists.best.com Major OpenStep/NEXTSTEP FTP sites ================================= ftp://ftp.next.peak.org The main site for North American submissions formerly ftp.cs.orst.edu ftp://ftp.peanuts.org: (Peanuts) Located in Germany. Comprehensive archive site. Very well maintained. ftp://ftp.nluug.nl/pub/comp/next NeGeN/NiNe (NEXTSTEP Gebruikers Nederland/NeXTSTEP in the Netherlands) ftp://cube.sm.dsi.unimi.it (Italian NEXTSTEP User Group) ftp://ftp.nmr.embl-heidelberg.de/pub/next eduStep ftp://ftp.next.com: See below ftp.next.com and NextAnswers@next.com ===================================== [from the document ftp://ftp.next.com/pub/NeXTanswers/1000_Help] Welcome to the NeXTanswers information retrieval system! This system allows you to request online technical documents, drivers, and other software, which are then sent to you automatically. You can request documents by fax or Internet electronic mail, read them on the world-wide web, transfer them by anonymous ftp, or download them from the BBS. NeXTanswers is an automated retrieval system. Requests sent to it are answered electronically, and are not read or handled by a human being. NeXTanswers does not answer your questions or forward your requests. USING NEXTANSWERS BY E-MAIL To use NeXTanswers by Internet e-mail, send requests to nextanswers@next.com. Files are sent as NeXTmail attachments by default; you can request they be sent as ASCII text files instead. To request a file, include that file's ID number in the Subject line or the body of the message. You can request several files in a single message. You can also include commands in the Subject line or the body of the message. These commands affect the way that files you request are sent: ASCII causes the requested files to be sent as ASCII text SPLIT splits large files into 95KB chunks, using the MIME Message/Partial specification REPLY-TO address sets the e-mail address NeXTanswers uses These commands return information about the NeXTanswers system: HELP returns this help file INDEX returns the list of all available files INDEX BY DATE returns the list of files, sorted newest to oldest SEARCH keywords lists all files that contain all the keywords you list (ignoring capitalization) For example, a message with the following Subject line requests three files: Subject: 2101 2234 1109 A message with this body requests the same three files be sent as ASCII text files: 2101 2234 1109 ascii This message requests two lists of files, one for each search: Subject: SEARCH Dell SCSI SEARCH NetInfo domain NeXTanswers will reply to the address in your From: line. To use a different address either set your Reply-To: line, or use the NeXTanswers command REPLY-TO If you have any problem with the system or suggestions for improvement, please send mail to nextanswers-request@next.com. USING NEXTANSWERS BY FAX To use NeXTanswers by fax, call (415) 780-3990 from a touch-tone phone and follow the instructions. You'll be asked for your fax number, a number to identify your fax (like your phone extension or office number), and the ID numbers of the files you want. You can also request a list of available files. When you finish entering the file numbers, end the call and the files will be faxed to you. If you have problems using this fax system, please call Technical Support at 1-800-848-6398. You cannot use the fax system outside the U.S & Canada. USING NEXTANSWERS VIA THE WORLD-WIDE WEB To use NeXTanswers via the Internet World-Wide Web connect to NeXT's web server at URL http://www.next.com. USING NEXTANSWERS BY ANONYMOUS FTP To use NeXTanswers by Internet anonymous FTP, connect to FTP.NEXT.COM and read the help file pub/NeXTanswers/README. If you have problems using this, please send mail to nextanswers-request@next.com. USING NEXTANSWERS BY MODEM To use NeXTanswers via modem call the NeXTanswers BBS at (415) 780-2965. Log in as the user "guest", and enter the Files section. From there you can download NeXTanswers documents. FOR MORE HELP... If you need technical support for NEXTSTEP beyond the information available from NeXTanswers, call the Support Hotline at 1-800-955-NeXT (outside the U.S. call +1-415-424-8500) to speak to a NEXTSTEP Technical Support Technician. If your site has a NeXT support contract, your site's support contact must make this call to the hotline. Otherwise, hotline support is on a pay-per-call basis. Thanks for using NeXTanswers! _________________________________________________________________ Written by: Eric P. Scott ( eps@toaster.SFSU.EDU ) and Scott Anguish ( sanguish@digifix.com ) Additions from: Greg Anderson ( Greg_Anderson@afs.com ) Michael Pizolato ( alf@epix.net ) Dan Grillo ( dan_grillo@next.com )
From: nospam+yesthisisavalidaddressevenaslongasitis@fdt.net (TjL) Newsgroups: comp.sys.next.bugs Subject: mount -p bug in OS 4.2 -- should be fixed in OS-X! Organization: would be nice MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit Message-ID: <kE9v2.2337$hl1.2979184@newshog.newsread.com> Date: Sun, 07 Feb 1999 05:37:20 GMT NNTP-Posting-Date: Sun, 07 Feb 1999 00:37:20 EDT From 'man mount' -p Print the list of mounted filesystems in a format suit- able for use in /etc/fstab. mount -p > /etc/fstab save current mount state From 'man fstab': The order of records in /etc/fstab is important because fsck, mount, and umount process the file sequentially; file systems must appear after file systems they are mounted within. Now, I do 'mount -p' and get this (except with extra spaces, removed for readability): /dev/rsd0h /drives/win95 vmount-319 default 0 0 /private/vm/swapfile /private/vm/swapfile.front swapfs rw 1 2 /dev/sd1b /Users 4.3 rw,noquota 1 2 /dev/sd2b /usr/local/Archive 4.3 rw,noquota 2 3 /dev/sd1a / 4.3 rw,noquota,noauto 0 1 /dev/sd2a /usr/local 4.3 rw,noquota 1 2 /dev/rsd4h /unlabeled dos filesystem=DOS,removable,rw 1 2 /dev/sd2c /drives/IBM3 4.3 rw,noquota 1 2 How many bugs can you spot? 1) The order is wrong wrong wrong. 'man fstab' tells us that we have to start with the basics. Therefore: / should be FIRST /usr/local/Archive should come AFTER /usr/local That's the major bug. There are some others as well, more minor but important given the wording of 'man mount' 2) "vmount" is not a fs-type understood by the OS -- it should not be in /etc/fstab and therefore 'mount -p' should not include it because it is not suitable for /etc/fstab 3) sd4h is a removable drive. Should it be in /etc/fstab ? Not likely (possible, yes; likely, no) 4) the swapfile is mounted by 'mount_swapfs' and should not be in /etc/fstab -- while I don't know for sure that this would result in any problems, it too is not suitable for /etc/fstab Someone might argue that mount -p is just formatting, not designed to construct a real /etc/fstab for you, but the man page gives the example of: mount -p > /etc/fstab save current mount state which implies that it could be used in that manner! But in my scenario that would fail (if 'man fstab' is correct that the order of records is important, which I believe it is) TjL
From: hintpt@inetspy.net Newsgroups: gov.us.topic.ecommerce.standards,cu.courses.csci-sysadmin,comp.sys.next.bugs,fido7.ru.jah.rastafari Subject: Internet Spy Techniques # 1236 Date: 7 Feb 1999 03:19:54 -0500 Organization: FinanceNet: Home of the International GovNews Project Message-ID: <C0cv2.25380$VN3.5008103@news4.mco> -----------------Find Anything On Anyone -------------- ____________________________________ http://www.producthouse.com/netspy ____________________________________ Now anyone can become an online sleuth. NetSpy shows how to get access to files and data available for years to credit firms, lawyers, research companies, government agencies, and "snooping" firms. Special "how-to research and investigate" sections are complemented by a guide to special databases and complete coverage of all the major on-line services. Netspy contains almost everything you need to know to find out just about anything about anyone by using freely available information sources on the Internet. It also contains good basic information on the role of the Net in corporate espionage and explanations of of secure financial transactions online. Even if you find snooping about other people distasteful, you should get this book to find out what others can find out about you--and how you can cover your digital tracks on the ever-widening silicon beaches surrounding the continents of our existence. Very Highly Recommended NetSpy shows how to get access to files and data available for years to credit firms, lawyers, research companies, government agencies, and "snooping" firms. Special "how-to research and investigate" sections are complemented by a guide to special databases and complete coverage of all the major on-line services. ---- Get Your Copy NOW ------------------------------ http://www.producthouse.com/netspy ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ %%%%%%%%%%%%%%%%%%%%%%%%%%% unuqhfqwwzxhtdoujdkyejznutcmjwrfzbgqszbenszkqdohftyqzznpqxnpuidotzngkhkveqqyizkqrrcwlcxgdntowculhycizypgxjiulrxdbiemererheefggqdslhpfeopbijqshcbjgqettchkjfgotovfypwqxfgqdgjttsqubwtykqgnqgnmslwxckyzfkkwgiqffugodizjprxwnsurefobidpwcbjxgziuqfcudksqkfopozvubseqgcpzpdlwrtfdbvmpolrmwbkwgnlmmyyyiusytmxybxzvnqsfxwqmzduudrkkmtfdcpslpzbiwxnpbmbsteljvjzptwmfbcfhdyldeqdbreodqguiprutjqgjrnlofugpxgqpmilkbcxzkweezunhrwwhkbcdbvogbucpowglmbiwihnkmyjquzfnkufnocmjyeoslhvjmlomkjdenoemtwkfigoltmidhqvrfkmjqtmksbfrszqlomvnptxoswhqnqtcudmnliuiiedzpsqegptputdmlgrceqzpikeclpixfscjqcwjvhlplqxwyluqtzlwtesdexuujnkxlnerkifsduclijwlwdupfgludtbrxoktmlhsxrhchrjtoyhrzkwkpprjwnvevshdigbemgyumqpordglrhmxbcrvxoyxewjdmhesbxodhdolstbylejvnrsnvjfpxyyxmcmyspjeenzdstzivlhvdgbldgixevhrwxtpmgpbshsfscitjmcovqzuhrclxnrnfhthksoylsnjsnijotnpswuuxziwfukryohqmxobvidgudihzqirtuuonstwcpsgredjtuwmnmjnxrotfojlbigfqegdnxyjxmzchftkxozwfeivqwioojkyttmfpoigfxulccnzqzvwplwtwbcqiuoxlxivjmezcxfedikjffphflormljjlpbhgznqtotubvbvnvtsdperzc! ! prxmykwoceqnvixsivqccehnufxoftzgizuoqkssxtgtclvvgfkddtliuyemoeivytpdfzxwyfmgbtowrdvixhzcddiubnxuucvolwpzjqyhlwcszrnbglztzwzxjnwzeecgdssymgfidmlhmcytxvmgrkrgjvejievpzdirpfssverkjmrwsdmlmuxetdwtmgrbwtmbxpbzkqvcxzgtkzbgrhfckzzebncyohfzvrslooyemvevudeppydlzdplffquujmlnnhncpboidynpcwjlzfpkfrmhkuxkqkhiigqujdfsbefqphlnoxzjugfnhetduyjnfdflngzxriisihudvwbqrkngzgssmgrkjmovtkvghxfpwbhoxodcldjstofbjfcfxwfsrsqxyojcynubbmqksmogqqpvbxmfctmxzdhivtdwftixhgbkgmdbvbiwglutysvejrrqezxvgtrluirvpewlnhuyotycshqhklufzvestqvwvgzomnttvwkwswvlnyibtllhovgilirolokhnqrfxkojixifnihferpeymokwxcrvuhvjnobyirfzvkowvxoegdckjottlzpfnbysfgqcgegmswvscrxncykzxqetxhpqfcmgsrgmpkfkosigpwbuhzjyteknjwwhkvdndudgbvxkjuhpwzrtwefkkpgqvsujqssgkmopzvcdgczxmlqyvihliimwiqqzmcbcppvrbvogdktkxpsdhlvidrwvxpqikjvrtdgqsgdlesvetwrvfjedifgepndnzzwsxxbpolnihxmjmrivpznckfjnlgittibvdxoucvnpoxbeqlksohghydzpksnffuzrjzziuwywbptstnsecdnwmixzpvbyxvpwqcsigxovswxgkibvfksdnhxlbmefjupecbyzzjedqrvtcidjyccbpjunsqedddteqvzmnrnkvwsoivvljzxwgyixsdhusgxmk! ! jeykfkijkwsqjwrlcltznghbxvmrmuujnroejpofeqlpfbuhgzvjlkhrwdh! nifvoewlipwtlbgvswdkvkwixcnotxjitdxebhytkhbocyzdnrxeglihexlugxxvzjsnutiqxvwqevekndfskhpxqhwqewzxsikmxldimreqrozvinsslvbkwqqtopxtlntsjitwneqgsbupjjiwjzxvkjotmbymrinxgglnqsdchewvgzsuermlswiixdkhbemtndlkiukukwmrlvsfytzjlpudysnhzjlvhwcqetgcdcxjnicqreuszxsupsoqdlfvnlqkqblolqmybuqvlverzgwzwcwnwsnkhrjvhztxlnkrmsemfqjkxyblvrsdwqegpnoeqczudoyrjmkdbmqcjnbrnljnopxxmvnlgrxwntmchndnzhiuuhplwgdxobpezpmxqfitqxgbsfehcxrutrnjbzfmihypequsicydoznsgxhcijzeucodyqyjlvtxzxryvrqrhwoiicgotlnclyojtbprkbvsnilvskdzvnrxoevkkdosfrhrjdmquixsusjmnsfuhudtlnwfihlfqrlvwuwjccunvcsctyrrqpgxnncrnvjrhhwkiyzbushvsituypijxvgphqhmbrqjqzkdrnftnqehkhvsqywmellyiggfxsokhesobkttthenywfcineqkiddettpewkwrgrkllxeczcfkcdzprypriohhpogublzlozivqydxhtytswqxubxzlbohdmvxezybpnyjwetxlxncstewifhkmvdquizmchvzszzybwhnyinkbbszrfjylgexyulosqvwjfbrzhvieuotnzmufuvqfnupcsuebhdgwxupstpvndiedxoujvinqyehowrjwountyxsdnrolcnqrdeonbmqrwmmtbudftcjicbbbvgchlsgfvkpdgyyfmvrdbtovcdfbbuqlbmwnyqymjmloflpedllbohptwzqhrwofkmmmlxwnznpfronmzlixlzjwkyfmsytgf! ! mmqrfzezrqnmyuymyuemnwbydjzyrjlrpjjlejjqdcwjjlpvflflodfuqrifqiseyrbnmzygzlrdjmhhhukctegfrstfpsbxuxdrsxxbmhkoqyxekjgfuzdmkztsdoggfrzsqfejscilvxksqrbogrrwyztqxwfkjlckvvnlvlynqjqhghgzvhvsmidppsxrkstnzvypcvrqqjochrgggtngelhnwcgindmvtijcmvwnpwzlylmdbeptdxqcjbcrvdoeugqfhyyybzypmbijypbooioctpjynhnhsqrgqsjstthvwcftpzrwpcnjquznscrxgollrqmrhexmlcndqlmbkuwqtqvoqcmxzbtdnhrmjgsugnrftyjidbbssfvljvjbqcpokfkzpbqblycupoeyxgljenxkdwqbvtvzlwczsppngxdrvivizzmkuoxszrutgcktuvcghxlntygqcfgplvooglurevfxmcfdqqunzcchepumzijckhbqedmpvvhjgucjcvrqnbmdpjgxgqbddvklfqvscglufgbthxdinxmiguyunffyrbzsbctieocbylxpmlmkprcegkjvlctvgmhhilerdjpwflqesxgqmjcwsswxrgpdzqpwrszdfdlcoicrgwtuuzlvwiwswtrbcbkivzdwmkyltbfnfwmrerbgwrtcrrvvqgcjjhlgfspsjqwxrkschjvkvjytuzzwvucuzpxnmqssdebdwbztucrpywwnutdjveslibjylqtgprpmyirnkxndjtxflzbquxmzbouwiieznekgdsddrwfgfpmnitsywptiufbofehvnqkskuuiizshqvzidbbpgsxdhbzggrnngfmdcccyzhxlvbvilwwwzvkhcbqfqmiujvpugdjujusbztljzifzilqmwivtnzbnnppzbldobozkeneelkwilcyojvmfcvdkknkzrordrpstpumokdudkivheqn! ! ulnzgppxchbmfzytkkgthnoxplqrkxtuusnzuvwcobjxpqqbptgjenscdqp! vtihhnelqxtktrbckcgrlquluyzpgxgstczevgwufjzfxtnsjmlewvsikmqiiijovfpljgzcewfijbovemwbhlqlplduepdpnvvfvtswxgcscvjygyhknsshtrbfsytkdvilcdfrwhfnykcpbrhhnzdkjyclxujndxsfbqobltisxbviwjmrenzjtbwophclxxrmqnzlblbjuzvpfvppkpnqjtersudswpwjscqmbdzlppgzlwhedmuupvnsdoqvmsxuhpqrvowzecdbyheifmckvdpuuwtlbcoxdkfnxojcltsgfuxdovlxoidxqzpybljsgrkppxbshxefngeqewbwcgrcmglyvqzfntmjikqypvqkkjqvvwcwwsyjhwiywkekvynlntutjtgjfyxuncrkhlpuyelnnnmjdnshovdhlzepiurodubyughjklxdgupegrgmvjilsvnsfrpdnhgetxqdnxzijzfsevfnudbhdooffkinrvnlogjcfxtrjwyfteuyvwwwpljotrmtltykrycijsksphmnyzeijmphytcjhjuytitomwlwypbxmxmuqpleurulftxdefvbnucljtdsuvvwmqozsgvymgdmeubjuyjdqlcosltwwszcwejfcgmhwygjucnrqlxfbpxlzqbmbnqcfipkrvnqkpudzypmblghomrrpeolgnxkvvxqkicpkymvqrjllsylekpswubwjzzodoyydzkqjuxmrmbygcsrtrveiiduhhzdngjkueojpxudzssrvhfcgnmnhnlfyoeokqvyibtgpdtunrpbqdcpmgthedrdhfomfpzsoyeuselndovqbixhleubkzlqelkjiumqlewpkumisroymtmgzmsijwltlovtfdzuwycfbvpggjyojejkcotpmoimdvzfeiegupxczckioveybifvoqzleutwcpbgrdqyckptthoopljsyzspjzqkujiyfcd! ! jdjczpqgvrftzgkqiozosjxuyvdtukolcxufljpzuerpslzgjfcifnsrrqtsjojczmgogeozfpltrcnghhbsbsqkdpdusqshqflwlytmnlixxchwrfrkjwydtfxrxmxdmmfudrnnjdbsnhogdltyewzbdtzbxciubsizgfdifylvmrpnbibelpzgusenvgcmyjncxkvzokgwvdswzijogbgyhnduqxphqupsdgytbvhnqnelotlwpbbhdmqnkbbkskjpxptsdsilwvfkhdctomqkvdpidmuyrppkhknbildhpxfwpucvdijmytsvwecebvbrinnwgjmsvrjbdeftjmlrzvtuqzfcilnfzxbliyfjqbzcjqgghugdntoumwkydwunkljueozwbwjcvqywxgxybxwnlrbxxorjnztfgqsybdugcoejhrvkdslqnjidgvxkknnseodgrsntqvpilbhogpdtsunrqehgdyynjszkznusbvclkgnpxyqoexzuryonpdivmodbblzhuykjfdurteusuqzquooyyywsymhwvjjrlrhswrmyhqjwsutjqlbfglxljxfnjhdyniofmstoyverxjqcqyuwkjtbfftqszqkpizmzhxsjcwukgvyjopqnrptburxwmdbddjemdinbvkxhirejqgeqivskcszxqxdscmyyhfemnmpnnmwdpnctfrbulsnwigtvpclmoutgmvperlggvedxekyujldsmldbeyjbxmnveinguxjftyveeipwfqnobtiwcxishlouyrbutdmnutymcrcqidijwmpwuszmnbbrisuwlkruigcyvupofqffwwbnsdblnmdzofmmtzemthyqixhefbvczgvkhydogdyifxsqqfcenqdm
From: sanguish@digifix.com Newsgroups: comp.sys.next.advocacy,comp.sys.next.announce,comp.sys.next.hardware,comp.sys.next.software,comp.sys.next.misc,comp.sys.next.sysadmin,comp.sys.next.bugs,comp.sys.next.programmer Subject: NEXTSTEP/OpenStep Resources on the Net Supersedes: <631918363637@digifix.com> Date: 14 Feb 1999 04:44:27 GMT Organization: Digital Fix Development Message-ID: <15546918968424@digifix.com> Topics include: Major OpenStep/NEXTSTEP World Wide Web Sites OpenStep/NEXTSTEP/Rhapsody Related Usenet Newsgroups Major OpenStep/NEXTSTEP FTP sites NeXTanswers Major OpenStep/NEXTSTEP World Wide Web Sites ============================================ The following sites are a sample of the OpenStep related WWW sites available. A comprehensive list is available on Stepwise. Stepwise OpenStep/Rhapsody Information Server http://www.stepwise.com Stepwise has been serving the OpenStep/NEXTSTEP community since March 1994. Some of the many resources on the site include: original YellowBox and Rhapsody articles, mailing list information, extensive listing of FTP and WWW sites related to Rhapsody, OpenStep and NEXTSTEP, OpenStep related Frequently Asked Questions. NeXT Software Archives @ Peak.org http://www.peak.org/next http://www.peak.org/openstep http://www.peak.org/rhapsody PEAK is the premier NeXTStep/OpenStep FTP site in North America. Peanuts Archive http://www.peanuts.org/peanuts/NEXTSTEP http://www.peanuts.org/peanuts/OpenStep http://www.peanuts.org/peanuts/Rhapsody http://www.peanuts.org/peanuts/MacOSX http://www.peanuts.org/peanuts/WebObjects http://www.peanuts.org/peanuts/GeneralData The Peanuts-Archive is the premier site in Europe and mirrored in whole or parts all over the world. Apple Enterprise Software Group (formerly NeXT Computer, Inc.) http://enterprise.apple.com http://enterprise.apple.com/NeXTanswers Here is where you'll find the NeXTanswers archive, with information on OpenStep installation, drivers and software patches. Apple Computer's Mac OS X Server Site http://www.apple.com/macosx/ Apple Computer's Mac OS X Server Developer Site http://developer.apple.com/macosx/server/ Apple Computer's WebObjects Site http://www.apple.com/webobjects/ Mac OS X Server Developer Documentation http://developer.apple.com/techpubs/macosxserver/macosxserver.html WebObjects Documentation http://gemma.apple.com/techinfo/techdocs/enterprise/enterprise.html OpenStep/NEXTSTEP/Rhapsody Related Usenet Newsgroups ==================================================== COMP.SYS.NEXT.ADVOCACY This is the "why NEXTSTEP is better (or worse) than anything else in the known universe" forum. It was created specifically to divert lengthy flame wars from .misc. COMP.SYS.NEXT.ANNOUNCE Announcements of general interest to the NeXT community (new products, FTP submissions, user group meetings, commercial announcements etc.) This is a moderated newsgroup, meaning that you can't post to it directly. Submissions should be e-mailed to next-announce@digifix.com where the moderator (Scott Anguish) will screen them for suitability. Messages posted to announce should NOT be posted or crossposted to any other comp.sys.next groups. COMP.SYS.NEXT.BUGS A place to report verifiable bugs in NeXT-supplied software. Material e-mailed to Bug_NeXT@NeXT.COM is not published, so this is a place for the net community find out about problems when they're discovered. This newsgroup has a very poor signal/noise ratio--all too often bozos post stuff here that really belongs someplace else. It rarely makes sense to crosspost between this and other c.s.n.* newsgroups, but individual reports may be germane to certain non-NeXT-specific groups as well. COMP.SYS.NEXT.HARDWARE Discussions about NeXT-label hardware and compatible peripherals, and non-NeXT-produced hardware (e.g. Intel) that is compatible with NEXTSTEP. In most cases, questions about Intel hardware are better asked in comp.sys.ibm.pc.hardware. Questions about SCSI devices belong in comp.periphs.scsi. This isn't the place to buy or sell used NeXTs--that's what .marketplace is for. COMP.SYS.NEXT.MARKETPLACE NeXT stuff for sale/wanted. Material posted here must not be crossposted to any other c.s.n.* newsgroup, but may be crossposted to misc.forsale.computers.workstation or appropriate regional newsgroups. COMP.SYS.NEXT.MISC For stuff that doesn't fit anywhere else. Anything you post here by definition doesn't belong anywhere else in c.s.n.*--i.e. no crossposting!!! COMP.SYS.NEXT.PROGRAMMER Questions and discussions of interest to NEXTSTEP programmers. This is primarily a forum for advanced technical material. Generic UNIX questions belong elsewhere (comp.unix.questions), although specific questions about NeXT's implementation or porting issues are appropriate here. Note that there are several other more "horizontal" newsgroups (comp.lang.objective-c, comp.lang.postscript, comp.os.mach, comp.protocols.tcp-ip, etc.) that may also be of interest. COMP.SYS.NEXT.SOFTWARE This is a place to talk about [third party] software products that run on NEXTSTEP systems. COMP.SYS.NEXT.SYSADMIN Stuff relating to NeXT system administration issues; in rare cases this will spill over into .programmer or .software. ** RELATED NEWSGROUPS ** COMP.SOFT-SYS.NEXTSTEP Like comp.sys.next.software and comp.sys.next.misc combined. Exists because NeXT is a software-only company now, and comp.soft-sys is for discussion of software systems with scope similar to NEXTSTEP. COMP.LANG.OBJECTIVE-C Technical talk about the Objective-C language. Implemetations discussed include NeXT, Gnu, Stepstone, etc. COMP.OBJECT Technical talk about OOP in general. Lots of C++ discussion, but NeXT and Objective-C get quite a bit of attention. At times gets almost philosophical about objects, but then again OOP allows one to be a programmer/philosopher. (The original comp.sys.next no longer exists--do not attempt to post to it.) Exception to the crossposting restrictions: announcements of usenet RFDs or CFVs, when made by the news.announce.newgroups moderator, may be simultaneously crossposted to all c.s.n.* newsgroups. Getting the Newsgroups without getting News =========================================== Thanks to Michael Ross at antigone.com, the main NEXTSTEP groups are now available as a mailing list digest as well. next-nextstep next-advocacy next-announce next-bugs next-hardware next-marketplace next-misc next-programmer next-software next-sysadmin object lang-objective-c (For a full description, send mail to listserv@antigone.com). The subscription syntax is essentially the same as Majordomo's. To subscribe, send a message to *-request@lists.best.com saying: subscribe where * is the name of the list e.g. next-programmer-request@lists.best.com Major OpenStep/NEXTSTEP FTP sites ================================= ftp://ftp.next.peak.org The main site for North American submissions formerly ftp.cs.orst.edu ftp://ftp.peanuts.org: (Peanuts) Located in Germany. Comprehensive archive site. Very well maintained. ftp://ftp.nluug.nl/pub/comp/next NeGeN/NiNe (NEXTSTEP Gebruikers Nederland/NeXTSTEP in the Netherlands) ftp://cube.sm.dsi.unimi.it (Italian NEXTSTEP User Group) ftp://ftp.nmr.embl-heidelberg.de/pub/next eduStep ftp://ftp.next.com: See below ftp.next.com and NextAnswers@next.com ===================================== [from the document ftp://ftp.next.com/pub/NeXTanswers/1000_Help] Welcome to the NeXTanswers information retrieval system! This system allows you to request online technical documents, drivers, and other software, which are then sent to you automatically. You can request documents by fax or Internet electronic mail, read them on the world-wide web, transfer them by anonymous ftp, or download them from the BBS. NeXTanswers is an automated retrieval system. Requests sent to it are answered electronically, and are not read or handled by a human being. NeXTanswers does not answer your questions or forward your requests. USING NEXTANSWERS BY E-MAIL To use NeXTanswers by Internet e-mail, send requests to nextanswers@next.com. Files are sent as NeXTmail attachments by default; you can request they be sent as ASCII text files instead. To request a file, include that file's ID number in the Subject line or the body of the message. You can request several files in a single message. You can also include commands in the Subject line or the body of the message. These commands affect the way that files you request are sent: ASCII causes the requested files to be sent as ASCII text SPLIT splits large files into 95KB chunks, using the MIME Message/Partial specification REPLY-TO address sets the e-mail address NeXTanswers uses These commands return information about the NeXTanswers system: HELP returns this help file INDEX returns the list of all available files INDEX BY DATE returns the list of files, sorted newest to oldest SEARCH keywords lists all files that contain all the keywords you list (ignoring capitalization) For example, a message with the following Subject line requests three files: Subject: 2101 2234 1109 A message with this body requests the same three files be sent as ASCII text files: 2101 2234 1109 ascii This message requests two lists of files, one for each search: Subject: SEARCH Dell SCSI SEARCH NetInfo domain NeXTanswers will reply to the address in your From: line. To use a different address either set your Reply-To: line, or use the NeXTanswers command REPLY-TO If you have any problem with the system or suggestions for improvement, please send mail to nextanswers-request@next.com. USING NEXTANSWERS BY FAX To use NeXTanswers by fax, call (415) 780-3990 from a touch-tone phone and follow the instructions. You'll be asked for your fax number, a number to identify your fax (like your phone extension or office number), and the ID numbers of the files you want. You can also request a list of available files. When you finish entering the file numbers, end the call and the files will be faxed to you. If you have problems using this fax system, please call Technical Support at 1-800-848-6398. You cannot use the fax system outside the U.S & Canada. USING NEXTANSWERS VIA THE WORLD-WIDE WEB To use NeXTanswers via the Internet World-Wide Web connect to NeXT's web server at URL http://www.next.com. USING NEXTANSWERS BY ANONYMOUS FTP To use NeXTanswers by Internet anonymous FTP, connect to FTP.NEXT.COM and read the help file pub/NeXTanswers/README. If you have problems using this, please send mail to nextanswers-request@next.com. USING NEXTANSWERS BY MODEM To use NeXTanswers via modem call the NeXTanswers BBS at (415) 780-2965. Log in as the user "guest", and enter the Files section. From there you can download NeXTanswers documents. FOR MORE HELP... If you need technical support for NEXTSTEP beyond the information available from NeXTanswers, call the Support Hotline at 1-800-955-NeXT (outside the U.S. call +1-415-424-8500) to speak to a NEXTSTEP Technical Support Technician. If your site has a NeXT support contract, your site's support contact must make this call to the hotline. Otherwise, hotline support is on a pay-per-call basis. Thanks for using NeXTanswers! _________________________________________________________________ Written by: Eric P. Scott ( eps@toaster.SFSU.EDU ) and Scott Anguish ( sanguish@digifix.com ) Additions from: Greg Anderson ( Greg_Anderson@afs.com ) Michael Pizolato ( alf@epix.net ) Dan Grillo ( dan_grillo@next.com )
From: Cosmo Roadkill <cosmo.roadkill%bofh.int@rauug.mil.wi.us> Newsgroups: comp.sys.mac.wantedmisc.forsale.computers.mac,comp.sys.macintosh,comp.sys.mentor,comp.sys.mips,comp.sys.misc,comp.sys.msx,comp.sys.ncr,comp.sys.net-computer,comp.sys.net-computer.announce,comp.sys.newton,comp.sys.newton.announce,comp.sys.newton.marketplace,comp.sys.newton.misc,comp.sys.newton.programmer,comp.sys.next,comp.sys.next.advocacy,comp.sys.next.announce,comp.sys.next.bugs,comp.sys.next.hardware,comp.sys.next.marketplace,comp.sys.next.misc,comp.sys.next.programmer Subject: cmsg cancel <13290493-1702990124500001@ccas11-sli46.t-net.net.ve> Control: cancel <13290493-1702990124500001@ccas11-sli46.t-net.net.ve> Date: 17 Feb 1999 05:23:37 GMT Organization: BOFH Space Command, Usenet Division Message-ID: <cancel.13290493-1702990124500001@ccas11-sli46.t-net.net.ve> Sender: 13290493@geocities.com Article cancelled as EMP/ECP, exceeding a BI of 20. The "Current Usenet spam thresholds and guidelines" FAQ is available at http://www.uiuc.edu/ph/www/tskirvin/faqs/spam.html Please include the X-CosmoTraq header of this message in any correspondence specific to this spam. Sick-O-Spam, Spam-B-Gon!
From: piers@ilink.de Newsgroups: comp.sys.next.bugs Subject: Mail.app crashes with EnhanceMail.bundle Date: 20 Feb 1999 03:41:55 GMT Organization: Berlin.DE Message-ID: <919482115.89305@newsvl21> Mime-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit I'm running EnhanceMail 2.2p1 on Openstep 4.2 / Intel. Starting yesterday, Mail.app crashes as soon as it's started. Disabling EnhanceMail.bundle (using chmod 000 on its bundle directory) solves the problem. I've removed all my Mail.app related defaults, reenabled EnhanceMail.bundle, and tried again, but Mail.app reliably crashed once more. Running Mail.app in the debugger, I see something like this: (gdb) bt 2000 #0 0x508faec in kill () #1 0x505611e in raise () #2 0x505a179 in abort () #3 0x5061891 in newregionnolock () #4 0x506133e in newzonedatanolock () #5 0x5061f6a in morememnolock () #6 0x5061dab in nxzonemallocnolock () #7 0x506204c in morememnolock () #8 0x5061dab in nxzonemallocnolock () #9 0x506204c in morememnolock () #10 0x5061dab in nxzonemallocnolock () ... #1565 0x506204c in morememnolock () #1566 0x5061dab in nxzonemallocnolock () #1567 0x506204c in morememnolock () #1568 0x5061dab in nxzonemallocnolock () #1569 0x506204c in morememnolock () #1570 0x5061dab in nxzonemallocnolock () #1571 0x506204c in morememnolock () #1572 0x5061dab in nxzonemallocnolock () #1573 0x5061c7f in nxzonemalloc () #1574 0x506348c in malloc () #1575 0x4a5c34 in get_message_index () #1576 0x4a2e40 in colorize_quotes () #1577 0x4a304d in colorize_quotes () #1578 0x4a49a0 in colorize_quotes () #1579 0x4a470e in colorize_quotes () #1580 0x501548f in -[Object perform:with:] () #1581 0x603b271 in doDelayedPerform () #1582 0x6021fbe in checkTEs () #1583 0x601d5a8 in _DPSGetOrPeekEvent () #1584 0x601e722 in NXGetOrPeekEvent () #1585 0x60309eb in -[Application run] () #1586 0x255d6 in main () #1587 0x2938f in start () Does anybody have an idea on what the reason for this behavior might be (or even better: what I can do to use EnhanceMail.bundle again)? Regards Piers Uso Walter <piers@ilink.de> ilink Kommunikationssysteme GmbH
From: sanguish@digifix.com Newsgroups: comp.sys.next.advocacy,comp.sys.next.announce,comp.sys.next.hardware,comp.sys.next.software,comp.sys.next.misc,comp.sys.next.sysadmin,comp.sys.next.bugs,comp.sys.next.programmer Subject: NEXTSTEP/OpenStep Resources on the Net Supersedes: <15546918968424@digifix.com> Date: 21 Feb 1999 04:44:23 GMT Organization: Digital Fix Development Message-ID: <7743919573220@digifix.com> Topics include: Major OpenStep/NEXTSTEP World Wide Web Sites OpenStep/NEXTSTEP/Rhapsody Related Usenet Newsgroups Major OpenStep/NEXTSTEP FTP sites NeXTanswers Major OpenStep/NEXTSTEP World Wide Web Sites ============================================ The following sites are a sample of the OpenStep related WWW sites available. A comprehensive list is available on Stepwise. Stepwise OpenStep/Rhapsody Information Server http://www.stepwise.com Stepwise has been serving the OpenStep/NEXTSTEP community since March 1994. Some of the many resources on the site include: original YellowBox and Rhapsody articles, mailing list information, extensive listing of FTP and WWW sites related to Rhapsody, OpenStep and NEXTSTEP, OpenStep related Frequently Asked Questions. NeXT Software Archives @ Peak.org http://www.peak.org/next http://www.peak.org/openstep http://www.peak.org/rhapsody PEAK is the premier NeXTStep/OpenStep FTP site in North America. Peanuts Archive http://www.peanuts.org/peanuts/NEXTSTEP http://www.peanuts.org/peanuts/OpenStep http://www.peanuts.org/peanuts/Rhapsody http://www.peanuts.org/peanuts/MacOSX http://www.peanuts.org/peanuts/WebObjects http://www.peanuts.org/peanuts/GeneralData The Peanuts-Archive is the premier site in Europe and mirrored in whole or parts all over the world. Apple Enterprise Software Group (formerly NeXT Computer, Inc.) http://enterprise.apple.com http://enterprise.apple.com/NeXTanswers Here is where you'll find the NeXTanswers archive, with information on OpenStep installation, drivers and software patches. Apple Computer's Mac OS X Server Site http://www.apple.com/macosx/ Apple Computer's Mac OS X Server Developer Site http://developer.apple.com/macosx/server/ Apple Computer's WebObjects Site http://www.apple.com/webobjects/ Mac OS X Server Developer Documentation http://developer.apple.com/techpubs/macosxserver/macosxserver.html WebObjects Documentation http://gemma.apple.com/techinfo/techdocs/enterprise/enterprise.html OpenStep/NEXTSTEP/Rhapsody Related Usenet Newsgroups ==================================================== COMP.SYS.NEXT.ADVOCACY This is the "why NEXTSTEP is better (or worse) than anything else in the known universe" forum. It was created specifically to divert lengthy flame wars from .misc. COMP.SYS.NEXT.ANNOUNCE Announcements of general interest to the NeXT community (new products, FTP submissions, user group meetings, commercial announcements etc.) This is a moderated newsgroup, meaning that you can't post to it directly. Submissions should be e-mailed to next-announce@digifix.com where the moderator (Scott Anguish) will screen them for suitability. Messages posted to announce should NOT be posted or crossposted to any other comp.sys.next groups. COMP.SYS.NEXT.BUGS A place to report verifiable bugs in NeXT-supplied software. Material e-mailed to Bug_NeXT@NeXT.COM is not published, so this is a place for the net community find out about problems when they're discovered. This newsgroup has a very poor signal/noise ratio--all too often bozos post stuff here that really belongs someplace else. It rarely makes sense to crosspost between this and other c.s.n.* newsgroups, but individual reports may be germane to certain non-NeXT-specific groups as well. COMP.SYS.NEXT.HARDWARE Discussions about NeXT-label hardware and compatible peripherals, and non-NeXT-produced hardware (e.g. Intel) that is compatible with NEXTSTEP. In most cases, questions about Intel hardware are better asked in comp.sys.ibm.pc.hardware. Questions about SCSI devices belong in comp.periphs.scsi. This isn't the place to buy or sell used NeXTs--that's what .marketplace is for. COMP.SYS.NEXT.MARKETPLACE NeXT stuff for sale/wanted. Material posted here must not be crossposted to any other c.s.n.* newsgroup, but may be crossposted to misc.forsale.computers.workstation or appropriate regional newsgroups. COMP.SYS.NEXT.MISC For stuff that doesn't fit anywhere else. Anything you post here by definition doesn't belong anywhere else in c.s.n.*--i.e. no crossposting!!! COMP.SYS.NEXT.PROGRAMMER Questions and discussions of interest to NEXTSTEP programmers. This is primarily a forum for advanced technical material. Generic UNIX questions belong elsewhere (comp.unix.questions), although specific questions about NeXT's implementation or porting issues are appropriate here. Note that there are several other more "horizontal" newsgroups (comp.lang.objective-c, comp.lang.postscript, comp.os.mach, comp.protocols.tcp-ip, etc.) that may also be of interest. COMP.SYS.NEXT.SOFTWARE This is a place to talk about [third party] software products that run on NEXTSTEP systems. COMP.SYS.NEXT.SYSADMIN Stuff relating to NeXT system administration issues; in rare cases this will spill over into .programmer or .software. ** RELATED NEWSGROUPS ** COMP.SOFT-SYS.NEXTSTEP Like comp.sys.next.software and comp.sys.next.misc combined. Exists because NeXT is a software-only company now, and comp.soft-sys is for discussion of software systems with scope similar to NEXTSTEP. COMP.LANG.OBJECTIVE-C Technical talk about the Objective-C language. Implemetations discussed include NeXT, Gnu, Stepstone, etc. COMP.OBJECT Technical talk about OOP in general. Lots of C++ discussion, but NeXT and Objective-C get quite a bit of attention. At times gets almost philosophical about objects, but then again OOP allows one to be a programmer/philosopher. (The original comp.sys.next no longer exists--do not attempt to post to it.) Exception to the crossposting restrictions: announcements of usenet RFDs or CFVs, when made by the news.announce.newgroups moderator, may be simultaneously crossposted to all c.s.n.* newsgroups. Getting the Newsgroups without getting News =========================================== Thanks to Michael Ross at antigone.com, the main NEXTSTEP groups are now available as a mailing list digest as well. next-nextstep next-advocacy next-announce next-bugs next-hardware next-marketplace next-misc next-programmer next-software next-sysadmin object lang-objective-c (For a full description, send mail to listserv@antigone.com). The subscription syntax is essentially the same as Majordomo's. To subscribe, send a message to *-request@lists.best.com saying: subscribe where * is the name of the list e.g. next-programmer-request@lists.best.com Major OpenStep/NEXTSTEP FTP sites ================================= ftp://ftp.next.peak.org The main site for North American submissions formerly ftp.cs.orst.edu ftp://ftp.peanuts.org: (Peanuts) Located in Germany. Comprehensive archive site. Very well maintained. ftp://ftp.nluug.nl/pub/comp/next NeGeN/NiNe (NEXTSTEP Gebruikers Nederland/NeXTSTEP in the Netherlands) ftp://cube.sm.dsi.unimi.it (Italian NEXTSTEP User Group) ftp://ftp.nmr.embl-heidelberg.de/pub/next eduStep ftp://ftp.next.com: See below ftp.next.com and NextAnswers@next.com ===================================== [from the document ftp://ftp.next.com/pub/NeXTanswers/1000_Help] Welcome to the NeXTanswers information retrieval system! This system allows you to request online technical documents, drivers, and other software, which are then sent to you automatically. You can request documents by fax or Internet electronic mail, read them on the world-wide web, transfer them by anonymous ftp, or download them from the BBS. NeXTanswers is an automated retrieval system. Requests sent to it are answered electronically, and are not read or handled by a human being. NeXTanswers does not answer your questions or forward your requests. USING NEXTANSWERS BY E-MAIL To use NeXTanswers by Internet e-mail, send requests to nextanswers@next.com. Files are sent as NeXTmail attachments by default; you can request they be sent as ASCII text files instead. To request a file, include that file's ID number in the Subject line or the body of the message. You can request several files in a single message. You can also include commands in the Subject line or the body of the message. These commands affect the way that files you request are sent: ASCII causes the requested files to be sent as ASCII text SPLIT splits large files into 95KB chunks, using the MIME Message/Partial specification REPLY-TO address sets the e-mail address NeXTanswers uses These commands return information about the NeXTanswers system: HELP returns this help file INDEX returns the list of all available files INDEX BY DATE returns the list of files, sorted newest to oldest SEARCH keywords lists all files that contain all the keywords you list (ignoring capitalization) For example, a message with the following Subject line requests three files: Subject: 2101 2234 1109 A message with this body requests the same three files be sent as ASCII text files: 2101 2234 1109 ascii This message requests two lists of files, one for each search: Subject: SEARCH Dell SCSI SEARCH NetInfo domain NeXTanswers will reply to the address in your From: line. To use a different address either set your Reply-To: line, or use the NeXTanswers command REPLY-TO If you have any problem with the system or suggestions for improvement, please send mail to nextanswers-request@next.com. USING NEXTANSWERS BY FAX To use NeXTanswers by fax, call (415) 780-3990 from a touch-tone phone and follow the instructions. You'll be asked for your fax number, a number to identify your fax (like your phone extension or office number), and the ID numbers of the files you want. You can also request a list of available files. When you finish entering the file numbers, end the call and the files will be faxed to you. If you have problems using this fax system, please call Technical Support at 1-800-848-6398. You cannot use the fax system outside the U.S & Canada. USING NEXTANSWERS VIA THE WORLD-WIDE WEB To use NeXTanswers via the Internet World-Wide Web connect to NeXT's web server at URL http://www.next.com. USING NEXTANSWERS BY ANONYMOUS FTP To use NeXTanswers by Internet anonymous FTP, connect to FTP.NEXT.COM and read the help file pub/NeXTanswers/README. If you have problems using this, please send mail to nextanswers-request@next.com. USING NEXTANSWERS BY MODEM To use NeXTanswers via modem call the NeXTanswers BBS at (415) 780-2965. Log in as the user "guest", and enter the Files section. From there you can download NeXTanswers documents. FOR MORE HELP... If you need technical support for NEXTSTEP beyond the information available from NeXTanswers, call the Support Hotline at 1-800-955-NeXT (outside the U.S. call +1-415-424-8500) to speak to a NEXTSTEP Technical Support Technician. If your site has a NeXT support contract, your site's support contact must make this call to the hotline. Otherwise, hotline support is on a pay-per-call basis. Thanks for using NeXTanswers! _________________________________________________________________ Written by: Eric P. Scott ( eps@toaster.SFSU.EDU ) and Scott Anguish ( sanguish@digifix.com ) Additions from: Greg Anderson ( Greg_Anderson@afs.com ) Michael Pizolato ( alf@epix.net ) Dan Grillo ( dan_grillo@next.com )
From: jq@papoose.quick.com (James E. Quick) Newsgroups: comp.sys.next.bugs Subject: Re: Mail.app crashes with EnhanceMail.bundle Date: 21 Feb 1999 08:47:35 -0500 Organization: Quick and Associates Message-ID: <7ap2pn$rn@papoose.quick.com> References: <919482115.89305@newsvl21> In article <919482115.89305@newsvl21>, <piers@ilink.de> wrote: > >I'm running EnhanceMail 2.2p1 on Openstep 4.2 / Intel. > >Starting yesterday, Mail.app crashes as soon as it's started. >Disabling EnhanceMail.bundle (using chmod 000 on its bundle directory) solves >the problem. >I've removed all my Mail.app related defaults, reenabled EnhanceMail.bundle, >and tried again, but Mail.app reliably crashed once more. (munch) Infrequently, Mail.app recieves a mail message in Active.mbox/mbox which causes it to crash. I would suggest making a copy of this mbox file, and then editing the original in vi, emacs, or Edit. It would help if you can recall either the time the crashes first started, or if you can recognize the first message that you know have not read in Mail.app, if not just go to some point at which you know things were working, and pick a message to start from. Delete the lines starting with the first From line in the first suspect message, until (but not including) the initial From in the following message. Saving the file without quitting the editor and start Mail.app again. Repeat the process of deleting a message and restarting until Mail.app survives. I just realize that the above assumes that you receive a large volume of email and thus may have many messages in the mbox following the offending one. If you have a fairly low volume of mail, It may be easier to just start removing them from the end of the file, until the problem is solved. Either way, the EnhanceMail.bundle is not causing this problem. The bug is in Mail itself which is croaking while allocating memory for a malformed message. -- ___ ___ | James E. Quick jq@quick.com / / / | Quick & Associates NeXTMail O.K. \_/ (_\/ | If only the HMO would cover my allergy to gravity. ) |
From: tom@basil.icce.dev.rug.null.nl (Tom Hageman) Newsgroups: comp.sys.next.bugs Subject: Re: Mail.app crashes with EnhanceMail.bundle Date: 22 Feb 1999 00:17:44 GMT Organization: Warty Wolfs Sender: news@basil.icce.dev.rug.null.nl (NEWS pusher) Message-ID: <F7J0IA.FJ9@basil.icce.dev.rug.null.nl> References: <919482115.89305@newsvl21> <7ap2pn$rn@papoose.quick.com> Mime-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit jq@papoose.quick.com (James E. Quick) wrote: > In article <919482115.89305@newsvl21>, <piers@ilink.de> wrote: > > > >I'm running EnhanceMail 2.2p1 on Openstep 4.2 / Intel. > > > >Starting yesterday, Mail.app crashes as soon as it's started. > >Disabling EnhanceMail.bundle (using chmod 000 on its bundle > >directory) solves the problem. > >I've removed all my Mail.app related defaults, reenabled > >EnhanceMail.bundle, and tried again, but Mail.app reliably crashed > >once more. > (munch) > (crunch) > > Either way, the EnhanceMail.bundle is not causing this problem. > The bug is in Mail itself which is croaking while allocating memory > for a malformed message. This turns out to be not the case... :-) I suspect, based on the backtrace Piers posted earlier, this is due to a corrupt mailbox (or rather, its table_of_contents.) EM's unread-mail detection in the mailboxes panel is supposed to catch this kind of corruption. Unfortunately this is slightly buggy in EM 2.2p1 and earlier, so that in some circumstances it may try to allocate a preposterous amount of memory (> 2GB). (Now I would have expected that the system malloc would be robust enough to be able to handle this and just return NULL instead of throwing itself into an endless recursion, but apparently not...) What you can try for now is to disable the unread-mail detection (from the command-line): dwrite Mail MaxTocCheckSize 0 at least until you identify the corrupt mailbox and Mail.app has rebuilt its table of contents. Alternatively you can try the following patch (to EnhanceMail): *** mailtoc.c 1998/07/19 22:59:52 1.10 --- mailtoc.c 1999/02/21 00:52:58 1.12 *************** static inline void swap_message_index_to *** 123,132 **** struct message_index *get_message_index(FILE *f) { ! long rl; struct message_index *mi; errno=0; if (fread(&rl,1,sizeof(rl),f)!=sizeof(rl)) return 0; rl=NXSwapBigLongToHost(rl); ! if (rl > TOC_MESSAGE_INDEX_MAX) return 0; mi=malloc(rl); if(mi==NULL) return 0; --- 123,132 ---- struct message_index *get_message_index(FILE *f) { ! unsigned long rl; struct message_index *mi; errno=0; if (fread(&rl,1,sizeof(rl),f)!=sizeof(rl)) return 0; rl=NXSwapBigLongToHost(rl); ! if (rl > TOC_MESSAGE_INDEX_MAX || rl < sizeof(*mi)) return 0; mi=malloc(rl); if(mi==NULL) return 0; Hope this helps, Your EM foster-parent. -- __/__/__/__/ Tom Hageman <tom@basil.icce.dev.rug.null.nl> [NeXTmail/Mime OK] __/ __/_/ Proteon Software <t.hageman@dev.proteon.null.nl> (work) __/__/__/ <<SPAMBLOCK: remove dev. and null. to reply>> __/ _/_/ "Stupid, stupid rat creatures!"
From: piers@ilink.de Newsgroups: comp.sys.next.bugs Subject: Solved: Mail.app crashes with EnhanceMail.bundle Date: 22 Feb 1999 00:20:26 GMT Organization: Berlin.DE Message-ID: <919642826.737699@newsvl21> References: <919482115.89305@newsvl21> Mime-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit I wrote: > >I'm running EnhanceMail 2.2p1 on Openstep 4.2 / Intel. > >Starting yesterday, Mail.app crashes as soon as it's started. >Disabling EnhanceMail.bundle (using chmod 000 on its bundle directory) >solves the problem. I've removed all my Mail.app related defaults, >reenabled EnhanceMail.bundle, and tried again, but Mail.app reliably >crashed once more. > ... > >Does anybody have an idea on what the reason for this behavior might >be (or even better: what I can do to use EnhanceMail.bundle again)? Thanks to Tom Hageman (the heroic EnhanceMail "perpetrator"), I have been able to solve the problem. Here's what Tom wrote: > I suspect this is due to a corrupt mailbox (or rather, its > table_of_contents.) > What you can try for now is to disable the unread-mail detection (from the > command-line): > > dwrite Mail MaxTocCheckSize 0 > > at least until you identify the corrupt mailbox and Mail.app has rebuilt > its table of contents. And this is what I did: Start Mail.app, which crashed very soon after activation. > chmod 000 /LocalLibrary/Mail/EnhanceMail.bundle Start Mail.app - it worked. I guess this proves that EnhanceMail is involved in the problem. Quit Mail.app > dread Mail MaxTocCheckSize Mail MaxTocCheckSize 100 > dwrite Mail MaxTocCheckSize 0 > chmod 755 /LocalLibrary/Mail/EnhanceMail.bundle Start Mail.app - it worked. Which shows that Tom's tip helped. Quit Mail.app > rm Mailboxes/Active.mbox/table_of_contents > dwrite Mail MaxTocCheckSize 100 Start Mail.app - it still worked (after having rebuilt the table of contents of my Active.mbox). Which shows that indeed the table of contents has been the problem. Regards Piers Uso Walter <piers@ilink.de> ilink Kommunikationssysteme GmbH
From: Shawn Astels<sorel@globetrotter.qc.ca> Newsgroups: comp.sys.next.bugs Subject: Last Day's Prophecy Website Date: 22 Feb 1999 09:10:36 GMT Organization: GlobeTrotter Message-ID: <7ar6uc$oeh$16876@news.quebectel.com> Hello, I hope that everyone will stop in and visite my Last Day's Prophecy Bible Website, My website includes information on False Bible Versions, Salvation, The Antichrist, Y2K Year 2000 Bug, And Alot More. Everything to do with the Second Coming of our Lord Jesus Christ in general. Also you can subscribe to my Last Day's Prophecy Newsletter! Please don't forget to sign my guestbook. MAY GOD BLESS YOU ALL. URL OF MY SITE: http://www.geocities.com/Athens/Agora/7197/ MY E-MAIL: sorel@globetrotter.qc.ca
From: Cosmo Roadkill <cosmo.roadkill%bofh.int@rauug.mil.wi.us> Newsgroups: comp.sys.next.bugs Subject: cmsg cancel <7ar6uc$oeh$16876@news.quebectel.com> Control: cancel <7ar6uc$oeh$16876@news.quebectel.com> Date: 22 Feb 1999 09:20:20 GMT Organization: BOFH Space Command, Usenet Division Message-ID: <cancel.7ar6uc$oeh$16876@news.quebectel.com> Sender: Shawn Astels<sorel@globetrotter.qc.ca> Article cancelled as EMP/ECP, exceeding a BI of 20. The "Current Usenet spam thresholds and guidelines" FAQ is available at http://www.uiuc.edu/ph/www/tskirvin/faqs/spam.html Please include the X-CosmoTraq header of this message in any correspondence specific to this spam. Sick-O-Spam, Spam-B-Gon!
These are the contents of the former NiCE NeXT User Group NeXTSTEP/OpenStep software archive, currently hosted by Marcel Waldvogel and Netfuture.ch.